RegulonDB RegulonDB 10.10: Gene Form
   

aer gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

aer patA nfeR Fis NtrC NtrC IHF FNR CRP NtrC patAp patAp aerp aerp TSS_3379 TSS_3379

Gene      
Name: aer    Texpresso search in the literature
Synonym(s): ECK3062, G7595, air, b3072, yqjJ
Genome position(nucleotides): 3217556 <-- 3219076 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.77
External database links:  
ASAP:
ABE-0010087
ECHOBASE:
EB2789
ECOLIHUB:
aer
OU-MICROARRAY:
b3072
STRING:
511145.b3072
COLOMBOS: aer


Product      
Name: aerotaxis receptor
Synonym(s): Aer, Air, YqjJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 55.066
Isoelectric point: 8.141
Motif(s):
 
Type Positions Sequence
31 -> 113 THANDTFVQVSGYTLQELQGQPHNMVRHPDMPKAAFADMWFTLKKGEPWSGIVKNRRKNGDHYWVRANAVPMVREGKISGYMS
191 -> 209 ILCALVVLLASACFEWQIV
263 -> 492 QVSSVRNGSETLAKGTDELNEHTQQTVDNVQQTVATMNQMAASVKQNSATASAADKLSITASNAAVQGGEAMTTVIKTMDDIADSTQRIGTITSLINDIAFQTNILALNAAVEAARAGEQGKGFAVVAGEVRHLASRSANAANDIRKLIDASADKVQSGSQQVHAAGRTMEDIVAQVKNVTQLIAQISHSTLEQADGLSSLTRAVDELNLITQKNAELVEESAQVSAMVK
167 -> 186 GVMTLMFILLAAMLWFVAAP
319 -> 472 LSITASNAAVQGGEAMTTVIKTMDDIADSTQRIGTITSLINDIAFQTNILALNAAVEAARAGEQGKGFAVVAGEVRHLASRSANAANDIRKLIDASADKVQSGSQQVHAAGRTMEDIVAQVKNVTQLIAQISHSTLEQADGLSSLTRAVDELNL

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
  5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0004888 - transmembrane signaling receptor activity
GO:0042802 - identical protein binding
biological_process GO:0007165 - signal transduction
GO:0006935 - chemotaxis
GO:0052131 - positive aerotaxis
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Bibikov SI., et al., 2000
[2] Buron-Barral MC., et al., 2006
[3] Gosink KK., et al., 2006
[4] Herrmann S., et al., 2004
[5] Samanta D., et al., 2016
[6] Stock AM. 1997
[7] Taylor BL. 2004
[8] Taylor BL., et al., 1998
[9] Taylor BL., et al., 1999
[10] Watts KJ., et al., 2006
[11] Watts KJ., et al., 2008
[12] Watts KJ., et al., 2004
External database links:  
DIP:
DIP-9061N
ECOCYC:
G7595-MONOMER
ECOLIWIKI:
b3072
INTERPRO:
IPR000014
INTERPRO:
IPR035965
INTERPRO:
IPR013655
INTERPRO:
IPR004090
INTERPRO:
IPR001610
INTERPRO:
IPR003660
INTERPRO:
IPR004089
MODBASE:
P50466
PFAM:
PF00015
PFAM:
PF08447
PRIDE:
P50466
PRINTS:
PR00260
PRODB:
PRO_000022063
PROSITE:
PS50111
REFSEQ:
NP_417543
SMART:
SM00283
SMART:
SM00086
SMR:
P50466
SWISSMODEL:
P50466
UNIPROT:
P50466


Operon      
Name: aer         
Operon arrangement:
Transcription unit        Promoter
aer


Transcriptional Regulation      
Display Regulation             
Activated by: CRP, FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3379 3219118 reverse nd [RS-EPT-CBR] [13]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Bibikov SI., Barnes LA., Gitin Y., Parkinson JS., 2000, Domain organization and flavin adenine dinucleotide-binding determinants in the aerotaxis signal transducer Aer of Escherichia coli., Proc Natl Acad Sci U S A 97(11):5830-5

 [2] Buron-Barral MC., Gosink KK., Parkinson JS., 2006, Loss- and gain-of-function mutations in the F1-HAMP region of the Escherichia coli aerotaxis transducer Aer., J Bacteriol 188(10):3477-86

 [3] Gosink KK., Buron-Barral MC., Parkinson JS., 2006, Signaling interactions between the aerotaxis transducer Aer and heterologous chemoreceptors in Escherichia coli., J Bacteriol 188(10):3487-93

 [4] Herrmann S., Ma Q., Johnson MS., Repik AV., Taylor BL., 2004, PAS domain of the Aer redox sensor requires C-terminal residues for native-fold formation and flavin adenine dinucleotide binding., J Bacteriol 186(20):6782-91

 [5] Samanta D., Widom J., Borbat PP., Freed JH., Crane BR., 2016, Bacterial Energy Sensor Aer Modulates the Activity of the Chemotaxis Kinase CheA Based on the Redox State of the Flavin Cofactor., J Biol Chem 291(50):25809-25814

 [6] Stock AM., 1997, Energy sensors for aerotaxis in Escherichia coli: something old, something new., Proc Natl Acad Sci U S A 94(20):10487-9

 [7] Taylor BL., 2004, An alternative strategy for adaptation in bacterial behavior., J Bacteriol 186(12):3671-3

 [8] Taylor BL., Zhulin IB., 1998, In search of higher energy: metabolism-dependent behaviour in bacteria., Mol Microbiol 28(4):683-90

 [9] Taylor BL., Zhulin IB., Johnson MS., 1999, Aerotaxis and other energy-sensing behavior in bacteria., Annu Rev Microbiol 53:103-28

 [10] Watts KJ., Johnson MS., Taylor BL., 2006, Minimal requirements for oxygen sensing by the aerotaxis receptor Aer., Mol Microbiol 59(4):1317-26

 [11] Watts KJ., Johnson MS., Taylor BL., 2008, Structure-function relationships in the HAMP and proximal signaling domains of the aerotaxis receptor Aer., J Bacteriol 190(6):2118-27

 [12] Watts KJ., Ma Q., Johnson MS., Taylor BL., 2004, Interactions between the PAS and HAMP domains of the Escherichia coli aerotaxis receptor Aer., J Bacteriol 186(21):7440-9

 [13] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB