RegulonDB RegulonDB 10.9: Gene Form
   

ygjK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ygjK fadH ygjJ ArcA FadR CRP HipB fadHp fadHp

Gene      
Name: ygjK    Texpresso search in the literature
Synonym(s): ECK3070, G7599, b3080
Genome position(nucleotides): 3228888 --> 3231239 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.46
External database links:  
ASAP:
ABE-0010118
ECHOBASE:
EB2581
ECOLIHUB:
ygjK
OU-MICROARRAY:
b3080
STRING:
511145.b3080
COLOMBOS: ygjK


Product      
Name: glycoside hydrolase
Synonym(s): YgjK
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 88.321
Isoelectric point: 6.071
Motif(s):
 
Type Positions Sequence
23 -> 783 ANADNYKNVINRTGAPQYMKDYDYDDHQRFNPFFDLGAWHGHLLPDGPNTMGGFPGVALLTEEYINFMASNFDRLTVWQDGKKVDFTLEAYSIPGALVQKLTAKDVQVEMTLRFATPRTSLLETKITSNKPLDLVWDGELLEKLEAKEGKPLSDKTIAGEYPDYQRKISATRDGLKVTFGKVRATWDLLTSGESEYQVHKSLPVQTEINGNRFTSKAHINGSTTLYTTYSHLLTAQEVSKEQMQIRDILARPAFYLTASQQRWEEYLKKGLTNPDATPEQTRVAVKAIETLNGNWRSPGGAVKFNTVTPSVTGRWFSGNQTWPWDTWKQAFAMAHFNPDIAKENIRAVFSWQIQPGDSVRPQDVGFVPDLIAWNLSPERGGDGGNWNERNTKPSLAAWSVMEVYNVTQDKTWVAEMYPKLVAYHDWWLRNRDHNGNGVPEYGATRDKAHNTESGEMLFTVKKGDKEETQSGLNNYARVVEKGQYDSLEIPAQVAASWESGRDDAAVFGFIDKEQLDKYVANGGKRSDWTVKFAENRSQDGTLLGYSLLQESVDQASYMYSDNHYLAEMATILGKPEEAKRYRQLAQQLADYINTCMFDPTTQFYYDVRIEDKPLANGCAGKPIVERGKGPEGWSPLFNGAATQANADAVVKVMLDPKEFNTFVPLGTAALTNPAFGADIYWRGRVWVDQFWFGLKGMERYGYRDDALKLADTFFRHAKGLTADGPIQENYNPLTGAQQGAPNFSWSAAHLYMLYNDFFRKQ
254 -> 299 LLTAQEVSKEQMQIRDILARPAFYLTASQQRWEEYLKKGLTNPDAT
24 -> 254 NADNYKNVINRTGAPQYMKDYDYDDHQRFNPFFDLGAWHGHLLPDGPNTMGGFPGVALLTEEYINFMASNFDRLTVWQDGKKVDFTLEAYSIPGALVQKLTAKDVQVEMTLRFATPRTSLLETKITSNKPLDLVWDGELLEKLEAKEGKPLSDKTIAGEYPDYQRKISATRDGLKVTFGKVRATWDLLTSGESEYQVHKSLPVQTEINGNRFTSKAHINGSTTLYTTYSHL
300 -> 783 PEQTRVAVKAIETLNGNWRSPGGAVKFNTVTPSVTGRWFSGNQTWPWDTWKQAFAMAHFNPDIAKENIRAVFSWQIQPGDSVRPQDVGFVPDLIAWNLSPERGGDGGNWNERNTKPSLAAWSVMEVYNVTQDKTWVAEMYPKLVAYHDWWLRNRDHNGNGVPEYGATRDKAHNTESGEMLFTVKKGDKEETQSGLNNYARVVEKGQYDSLEIPAQVAASWESGRDDAAVFGFIDKEQLDKYVANGGKRSDWTVKFAENRSQDGTLLGYSLLQESVDQASYMYSDNHYLAEMATILGKPEEAKRYRQLAQQLADYINTCMFDPTTQFYYDVRIEDKPLANGCAGKPIVERGKGPEGWSPLFNGAATQANADAVVKVMLDPKEFNTFVPLGTAALTNPAFGADIYWRGRVWVDQFWFGLKGMERYGYRDDALKLADTFFRHAKGLTADGPIQENYNPLTGAQQGAPNFSWSAAHLYMLYNDFFRKQ
1 -> 23 MKIKTILTPVTCALLISFSAHAA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
molecular_function GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0015926 - glucosidase activity
GO:0016798 - hydrolase activity, acting on glycosyl bonds
GO:0004555 - alpha,alpha-trehalase activity
biological_process GO:0008152 - metabolic process
GO:0005975 - carbohydrate metabolic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0005991 - trehalose metabolic process
Note(s): Note(s): ...[more].
External database links:  
CAZY:
GH63
ECOCYC:
G7599-MONOMER
ECOLIWIKI:
b3080
INTERPRO:
IPR012341
INTERPRO:
IPR008928
INTERPRO:
IPR001661
MINT:
P42592
MODBASE:
P42592
PANTHER:
PTHR23403
PDB:
5GW7
PDB:
3W7S
PDB:
3W7T
PDB:
3W7U
PDB:
3W7W
PDB:
5CA3
PDB:
3W7X
PDB:
3D3I
PFAM:
PF01204
PRIDE:
P42592
REFSEQ:
NP_417551
SMR:
P42592
UNIPROT:
P42592


Operon      
Name: ygjJK         
Operon arrangement:
Transcription unit        Promoter
ygjJK


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB