RegulonDB RegulonDB 10.9: Gene Form
   

higB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fadH rlmG higA higB HigBA HigA HigBA anti-anti-terminator higBp higBp higAp8 higAp8

Gene      
Name: higB    Texpresso search in the literature
Synonym(s): ECK3073, G7602, b3083, ygjN
Genome position(nucleotides): 3234141 <-- 3234455 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
38.41
External database links:  
ASAP:
ABE-0010128
ECHOBASE:
EB2584
ECOLIHUB:
higB
OU-MICROARRAY:
b3083
STRING:
511145.b3083
COLOMBOS: higB


Product      
Name: ribosome-dependent mRNA interferase toxin HigB
Synonym(s): HigB, YgjN, translation-dependent mRNA interferase, toxin of the HigB-HigA toxin-antitoxin system
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 12.103
Isoelectric point: 10.043
Motif(s):
 
Type Positions Sequence
20 -> 92 KTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKCYIREVMTHKEYD

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.1 - translation attenuation and efficiency
Gene Ontology Terms (GO)  
cellular_component GO:0110001 - toxin-antitoxin complex
GO:0005829 - cytosol
molecular_function GO:0004518 - nuclease activity
GO:0016788 - hydrolase activity, acting on ester bonds
GO:0004519 - endonuclease activity
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0003723 - RNA binding
GO:0004521 - endoribonuclease activity
biological_process GO:0017148 - negative regulation of translation
GO:0043488 - regulation of mRNA stability
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
GO:0090502 - RNA phosphodiester bond hydrolysis, endonucleolytic
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7602-MONOMER
ECOLIWIKI:
b3083
INTERPRO:
IPR018669
PDB:
5IFG
PFAM:
PF09907
PRIDE:
P64578
REFSEQ:
NP_417554
SMR:
P64578
UNIPROT:
P64578


Operon      
Name: higBA         
Operon arrangement:
Transcription unit        Promoter
higBA


Transcriptional Regulation      
Display Regulation             
Repressed by: HigBA, HigA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter higAp8 3234341 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB