RegulonDB RegulonDB 10.9: Gene Form
   

yraR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yraQ yraR yhbO yhbP anti-anti-terminator anti-terminator terminator yraRp1 yraRp1 yraRp6 yraRp6 TSS_3419 TSS_3419 yraRp yraRp yraQp4 yraQp4 yraQp3 yraQp3

Gene      
Name: yraR    Texpresso search in the literature
Synonym(s): ECK3140, G7646, b3152
Genome position(nucleotides): 3298211 <-- 3298846 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.87
External database links:  
ASAP:
ABE-0010356
ECHOBASE:
EB2636
ECOLIHUB:
yraR
OU-MICROARRAY:
b3152
STRING:
511145.b3152
COLOMBOS: yraR


Product      
Name: putative nucleoside-diphosphate-sugar epimerase
Synonym(s): YraR
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 23.198
Isoelectric point: 8.756
Motif(s):
 
Type Positions Sequence
8 -> 188 GATGLVGGHLLRMLINEPKVNAIAAPTRRPLGDMPGVFNPHDPQLSDALAQVTDPIDIVFCCLGTTRREAGSKEAFIHADYTLVVDTALTGRRLGAQHMLVVSAMGANAHSPFFYNRVKGEMEEALIAQNWPKLTIARPSMLLGDRSKQRMNETLFAPLFRLLPGNWKSIDARDVARVMLA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0016620 - oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
GO:0051287 - NAD binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12902N
ECOCYC:
G7646-MONOMER
ECOLIWIKI:
b3152
INTERPRO:
IPR000534
INTERPRO:
IPR016040
INTERPRO:
IPR036291
MODBASE:
P45469
PFAM:
PF13460
PRIDE:
P45469
REFSEQ:
NP_417621
SMART:
SM00859
SMR:
P45469
SWISSMODEL:
P45469
UNIPROT:
P45469


Operon      
Name: yraR         
Operon arrangement:
Transcription unit        Promoter
yraR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yraQp3 3298174 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yraQp4 3298207 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter TSS_3419 3298912 reverse nd [RS-EPT-CBR] [2]
  promoter yraRp6 3298923 reverse Similarity to the consensus
Read more >
[ICWHO] [1]
  promoter yraRp1 3299012 reverse Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB