RegulonDB RegulonDB 10.9: Gene Form
   

yhbS gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ubiU ubiT yhbS yhbP yhbQ yhbO CsgD CsgD terminator anti-terminator anti-anti-terminator terminator TSS_3428 TSS_3428 yhbUp5 yhbUp5 ubiTp1 ubiTp1 yhbUp1 yhbUp1 TSS_3427 TSS_3427 ubiTp2 ubiTp2 yhbUp7 yhbUp7 TSS_3425 (cluster) TSS_3425 (cluster) TSS_3424 TSS_3424 TSS_3423 TSS_3423 TSS_3422 TSS_3422 TSS_3421 TSS_3421 yhbQp2 yhbQp2 TSS_3420 TSS_3420

Gene      
Name: yhbS    Texpresso search in the literature
Synonym(s): ECK3144, G7650, b3156
Genome position(nucleotides): 3300255 <-- 3300758 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.56
External database links:  
ASAP:
ABE-0010373
ECHOBASE:
EB2640
ECOLIHUB:
yhbS
OU-MICROARRAY:
b3156
STRING:
511145.b3156
COLOMBOS: yhbS


Product      
Name: putative N-acetyltransferase YhbS
Synonym(s): YhbS, putative acyltransferase with acyl-CoA N-acyltransferase domain
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.534
Isoelectric point: 4.329
Motif(s):
 
Type Positions Sequence
45 -> 123 VATDDEGQVIGYVAFSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYSRFGFE
1 -> 148 MLIRVEIPIDAPGIDALLRRSFESDAEAKLVHDLREDGFLTLGLVATDDEGQVIGYVAFSPVDVQGEDLQWVGMAPLAVDEKYRGQGLARQLVYEGLDSLNEFGYAAVVTLGDPALYSRFGFELAAHHDLRCRWPGTESAFQVHRLAD

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016740 - transferase activity
GO:0008080 - N-acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7650-MONOMER
ECOLIWIKI:
b3156
INTERPRO:
IPR000182
INTERPRO:
IPR016181
MODBASE:
P63417
PFAM:
PF13508
PRIDE:
P63417
PROSITE:
PS51186
REFSEQ:
NP_417625
SMR:
P63417
UNIPROT:
P63417


Operon      
Name: ubiT-yhbS         
Operon arrangement:
Transcription unit        Promoter
ubiT-yhbS
ubiT-yhbS


Transcriptional Regulation      
Display Regulation             
Repressed by: CsgD


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3420 3299936 reverse nd [RS-EPT-CBR] [1]
  promoter yhbQp2 3299939 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_3421 3300908 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3422 3300960 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3423 3300965 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3424 3300967 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3425 (cluster) 3301010 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter yhbUp7 3301279 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_3427 3301317 reverse nd [RS-EPT-CBR] [1]
  promoter yhbUp1 3301329 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yhbUp5 3301437 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_3428 3301439 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB