RegulonDB RegulonDB 10.9: Gene Form
   

yhbX gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yhbX argG leuU yhbXp6 yhbXp6 TSS_3475 TSS_3475 TSS_3474 (cluster) TSS_3474 (cluster) TSS_3473 TSS_3473

Gene      
Name: yhbX    Texpresso search in the literature
Synonym(s): ECK3162, G7655, b3173
Genome position(nucleotides): 3319988 <-- 3321613 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.05
External database links:  
ASAP:
ABE-0010430
ECHOBASE:
EB2645
ECOLIHUB:
yhbX
OU-MICROARRAY:
b3173
STRING:
511145.b3173
COLOMBOS: yhbX


Product      
Name: putative hydrolase YhbX
Synonym(s): YhbX, putative hydrolase, inner membrane
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 60.753
Isoelectric point: 7.205
Motif(s):
 
Type Positions Sequence
61 -> 81 LLVAAPFVLLTAADMSISLYS
224 -> 462 TYVLIVGESVRVDNMSLYGYTRSTTPQVEAQRKQIKLFNQAISGAPYTALSVPLSLTADSVLSHDIHNYPDNIINMANQAGFQTFWLSSQSAFRQNGTAVTSIAMRAMETVYVRGFDELLLPHLSQALQQNTQQKKLIVLHLNGSHEPACSAYPQSSAVFQPQDDQDACYDNSIHYTDSLLGQVFELLKDRRASVMYFADHGLERDPTKKNVYFHGGREASQQAYHVPMFIWYSPVLGD
142 -> 162 VTGILLLIVISGSLFSACQFA
111 -> 131 MYIPYLCAFAFLSLLFLAVII
265 -> 285 ISGAPYTALSVPLSLTADSVL

 

Classification:
Multifun Terms (GenProtEC)  
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0003824 - catalytic activity
GO:0016740 - transferase activity
GO:0016772 - transferase activity, transferring phosphorus-containing groups
GO:0016776 - phosphotransferase activity, phosphate group as acceptor
GO:0008484 - sulfuric ester hydrolase activity
biological_process GO:0009244 - lipopolysaccharide core region biosynthetic process
Note(s): Note(s): ...[more].
Reference(s): [1] Kim SH., et al., 2006
External database links:  
ECOCYC:
G7655-MONOMER
ECOLIWIKI:
b3173
INTERPRO:
IPR017850
INTERPRO:
IPR040423
INTERPRO:
IPR000917
MODBASE:
P42640
PANTHER:
PTHR30443
PFAM:
PF00884
PRIDE:
P42640
REFSEQ:
NP_417641
UNIPROT:
P42640


Operon      
Name: yhbX         
Operon arrangement:
Transcription unit        Promoter
yhbX


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3473 3318996 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3474 (cluster) 3318998 forward For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3475 3319007 forward nd [RS-EPT-CBR] [2]
  promoter yhbXp6 3321651 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Kim SH., Jia W., Parreira VR., Bishop RE., Gyles CL., 2006, Phosphoethanolamine substitution in the lipid A of Escherichia coli O157 : H7 and its association with PmrC., Microbiology 152(Pt 3):657-66

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB