RegulonDB RegulonDB 11.1: Gene Form
   

mlaB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mlaC mlaD mlaB ibaG MlrA TSS_3503 TSS_3503 TSS_3502 TSS_3502 ibaGp4 ibaGp4 ibaGp9 ibaGp9 ibaGp2 ibaGp2 ibaGp1 ibaGp1 TSS_3501 (cluster) TSS_3501 (cluster)

Gene      
Name: mlaB    Texpresso search in the literature
Synonym(s): ECK3180, G7658, b3191, yrbB
Genome position(nucleotides): 3336963 <-- 3337256
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.4
External database links:  
ASAP:
ABE-0010487
ECHOBASE:
EB2649
ECOLIHUB:
mlaB
OU-MICROARRAY:
b3191
STRING:
511145.b3191
COLOMBOS: mlaB


Product      
Name: intermembrane phospholipid transport system protein MlaB
Synonym(s): MlaB, YrbB
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,membrane
Molecular weight: 10.68
Isoelectric point: 4.52
Motif(s):
 
Type Positions Sequence Comment
1 -> 97 MSESLSWMQTGDTLALSGELDQDVLLPLWEMREEAVKGITCIDLSRVSRVDTGGLALLLHLIDLAKKQGNNVTLQGVNDKVYTLAKLYNLPADVLPR UniProt: STAS.
14 -> 90 LALSGELDQDVLLPLWEMREEAVKGITCIDLSRVSRVDTGGLALLLHLIDLAKKQGNNVTLQGVNDKVYTLAKLYNL
52 -> 52 T UniProt: Does not affect the assembly of the MlaFEB complex, but abolishes ATPase activity..

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:1990531 - phospholipid-translocating ATPase complex
GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0016020 - membrane
molecular_function GO:0120014 - phospholipid transfer activity
GO:0005515 - protein binding
biological_process GO:0120010 - intermembrane phospholipid transfer
GO:0006974 - cellular response to DNA damage stimulus
GO:0046677 - response to antibiotic
GO:0015914 - phospholipid transport
Note(s): Note(s): ...[more].
Reference(s): [1] Coudray N., et al., 2020
[2] Ekiert DC., et al., 2017
[3] Hughes GW., et al., 2019
[4] Kolich LR., et al., 2020
External database links:  
ALPHAFOLD:
P64602
DIP:
DIP-47898N
ECOCYC:
G7658-MONOMER
ECOLIWIKI:
b3191
INTERPRO:
IPR002645
INTERPRO:
IPR036513
MODBASE:
P64602
PDB:
7CGE
PDB:
7CGN
PDB:
6XGZ
PDB:
6XGY
PDB:
7CH0
PFAM:
PF13466
PRIDE:
P64602
PROSITE:
PS50801
REFSEQ:
NP_417658
SMR:
P64602
UNIPROT:
P64602


Operon      
Name: mlaFEDCB         
Operon arrangement:
Transcription unit        Promoter
mlaFEDCB
mlaFEDCB
mlaFEDCB


Transcriptional Regulation      
Display Regulation             
Activated by: MarA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3501 (cluster) 3336555 reverse nd [RS-EPT-CBR] [5]
  promoter ibaGp9 3336954 reverse nd [COMP-AINF] [6]
  promoter ibaGp4 3336983 reverse nd [COMP-AINF] [6]
  promoter TSS_3502 3337936 reverse nd [RS-EPT-CBR] [5]
  promoter TSS_3503 3338185 reverse nd [RS-EPT-CBR] [5]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [COMP-AINF] Inferred computationally without human oversight



Reference(s)    

 [1] Coudray N., Isom GL., MacRae MR., Saiduddin MN., Bhabha G., Ekiert DC., 2020, Structure of bacterial phospholipid transporter MlaFEDB with substrate bound., Elife 9

 [2] Ekiert DC., Bhabha G., Isom GL., Greenan G., Ovchinnikov S., Henderson IR., Cox JS., Vale RD., 2017, Architectures of Lipid Transport Systems for the Bacterial Outer Membrane., Cell 169(2):273-285.e17

 [3] Hughes GW., Hall SCL., Laxton CS., Sridhar P., Mahadi AH., Hatton C., Piggot TJ., Wotherspoon PJ., Leney AC., Ward DG., Jamshad M., Spana V., Cadby IT., Harding C., Isom GL., Bryant JA., Parr RJ., Yakub Y., Jeeves M., Huber D., Henderson IR., Clifton LA., Lovering AL., Knowles TJ., 2019, Evidence for phospholipid export from the bacterial inner membrane by the Mla ABC transport system., Nat Microbiol 4(10):1692-1705

 [4] Kolich LR., Chang YT., Coudray N., Giacometti SI., MacRae MR., Isom GL., Teran EM., Bhabha G., Ekiert DC., 2020, Structure of MlaFB uncovers novel mechanisms of ABC transporter regulation., Elife 9

 [5] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [6] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB