RegulonDB RegulonDB 10.9: Gene Form
   

mlaC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mlaC mlaD mlaB ibaG MlrA TSS_3503 TSS_3503 TSS_3502 TSS_3502 ibaGp4 ibaGp4 ibaGp9 ibaGp9 ibaGp2 ibaGp2 ibaGp ibaGp TSS_3501 (cluster) TSS_3501 (cluster)

Gene      
Name: mlaC    Texpresso search in the literature
Synonym(s): ECK3181, G7659, b3192, yrbC
Genome position(nucleotides): 3337256 <-- 3337891 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.36
External database links:  
ASAP:
ABE-0010489
ECHOBASE:
EB2650
ECOLIHUB:
mlaC
OU-MICROARRAY:
b3192
STRING:
511145.b3192
COLOMBOS: mlaC


Product      
Name: intermembrane phospholipid transport system - periplasmic binding protein
Synonym(s): MlaC, YrbC
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 23.963
Isoelectric point: 9.765
Motif(s):
 
Type Positions Sequence
1 -> 21 MFKRLMMVALLVIAPLSAATA
22 -> 211 ADQTNPYKLMDEAAQKTFDRLKNEQPQIRANPDYLRTIVDQELLPYVQVKYAGALVLGQYYKSATPAQREAYFAAFREYLKQAYGQALAMYHGQTYQIAPEQPLGDKTIVPIRVTIIDPNGRPPVRLDFQWRKNSQTGNWQAYDMIAEGVSMITTKQNEWGTLLRTKGIDGLTAQLKSISQQKITLEEKK
33 -> 198 EAAQKTFDRLKNEQPQIRANPDYLRTIVDQELLPYVQVKYAGALVLGQYYKSATPAQREAYFAAFREYLKQAYGQALAMYHGQTYQIAPEQPLGDKTIVPIRVTIIDPNGRPPVRLDFQWRKNSQTGNWQAYDMIAEGVSMITTKQNEWGTLLRTKGIDGLTAQLK

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
molecular_function GO:0005515 - protein binding
biological_process GO:0120010 - intermembrane phospholipid transfer
GO:0015914 - phospholipid transport
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Malinverni JC., et al., 2009
External database links:  
ECOCYC:
G7659-MONOMER
ECOLIWIKI:
b3192
INTERPRO:
IPR042245
INTERPRO:
IPR008869
PANTHER:
PTHR36573
PDB:
5UWA
PDB:
6GKI
PFAM:
PF05494
PRIDE:
P0ADV7
REFSEQ:
NP_417659
SMR:
P0ADV7
UNIPROT:
P0ADV7


Operon      
Name: mlaFEDCB         
Operon arrangement:
Transcription unit        Promoter
mlaFEDCB
mlaFEDCB
mlaFEDCB


Transcriptional Regulation      
Display Regulation             
Activated by: MarA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3501 (cluster) 3336555 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter ibaGp9 3336954 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter ibaGp4 3336983 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_3502 3337936 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3503 3338185 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Malinverni JC., Silhavy TJ., 2009, An ABC transport system that maintains lipid asymmetry in the gram-negative outer membrane., Proc Natl Acad Sci U S A 106(19):8009-14

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB