RegulonDB RegulonDB 10.9: Gene Form
   

lptA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

lptB lptC kdsC lptA rpoNp rpoNp TSS_3513 TSS_3513 lptBp lptBp lptAp1 lptAp1 TSS_3512 TSS_3512 TSS_3511 TSS_3511 lptAp2 lptAp2 TSS_3510 TSS_3510 TSS_3509 TSS_3509

Gene      
Name: lptA    Texpresso search in the literature
Synonym(s): ECK3189, G7665, b3200, yhbN
Genome position(nucleotides): 3343380 --> 3343937 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.64
External database links:  
ASAP:
ABE-0010510
ECHOBASE:
EB2502
ECOLIHUB:
lptA
OU-MICROARRAY:
b3200
STRING:
511145.b3200
COLOMBOS: lptA


Product      
Name: lipopolysaccharide transport system protein LptA
Synonym(s): LptA, YhbN
Sequence: Get amino acid sequence Fasta Format
Cellular location: outer membrane,periplasmic space
Molecular weight: 20.127
Isoelectric point: 9.545
Motif(s):
 
Type Positions Sequence
76 -> 76 R
1 -> 27 MKFKTNKLSLNLVLASSLLAASIPAFA
37 -> 149 HIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQK
148 -> 149 QK
36 -> 36 I

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.3 - Primary Active Transporters --> 4.3.A - Pyrophosphate Bond (ATP; GTP; P2) Hydrolysis-driven Active Transporters --> 4.3.A.1 - The ATP-binding Cassette (ABC) Superfamily + ABC-type Uptake Permeases --> 4.3.A.1.p - ABC superfamily, periplasmic binding component
Gene Ontology Terms (GO)  
cellular_component GO:0009279 - cell outer membrane
GO:0030288 - outer membrane-bounded periplasmic space
GO:0042597 - periplasmic space
GO:1990351 - transporter complex
molecular_function GO:0005515 - protein binding
GO:0017089 - glycolipid transfer activity
GO:0042802 - identical protein binding
GO:0001530 - lipopolysaccharide binding
biological_process GO:0015920 - lipopolysaccharide transport
GO:0043165 - Gram-negative-bacterium-type cell outer membrane assembly
GO:0046836 - glycolipid transport
Note(s): Note(s): ...[more].
Reference(s): [1] Falchi FA., et al., 2018
[2] Schultz KM., et al., 2013
[3] Schultz KM., et al., 2018
[4] Schultz KM., et al., 2017
[5] Schultz KM., et al., 2017
[6] Vetterli SU., et al., 2018
External database links:  
DIP:
DIP-12262N
ECOCYC:
YHBN-MONOMER
ECOLIWIKI:
b3200
INTERPRO:
IPR014340
INTERPRO:
IPR005653
PDB:
2R19
PDB:
2R1A
PDB:
6GD5
PFAM:
PF03968
PRIDE:
P0ADV1
PRODB:
PRO_000023113
REFSEQ:
NP_417667
SMR:
P0ADV1
UNIPROT:
P0ADV1


Operon      
Name: yrbG-kdsDC-lptCAB-rpoN-hpf-ptsN-rapZ-npr         
Operon arrangement:
Transcription unit        Promoter
yrbG-kdsD
yrbG-kdsDC-lptCAB
kdsC-lptCAB
kdsC-lptCAB
kdsC-lptCAB
lptAB
lptAB
lptB-rpoN-hpf-ptsN-yhbJ
rpoN-hpf-ptsN-yhbJ-npr


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3509 3343164 forward nd [RS-EPT-CBR] [7]
  promoter TSS_3510 3343168 forward nd [RS-EPT-CBR] [7]
  promoter TSS_3511 3343300 forward nd [RS-EPT-CBR] [7]
  promoter TSS_3512 3343302 forward nd [RS-EPT-CBR] [7]
  promoter TSS_3513 3343446 forward nd [RS-EPT-CBR] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Falchi FA., Maccagni EA., Puccio S., Peano C., De Castro C., Palmigiano A., Garozzo D., Martorana AM., Polissi A., Deho G., Sperandeo P., 2018, Mutation and Suppressor Analysis of the Essential Lipopolysaccharide Transport Protein LptA Reveals Strategies To Overcome Severe Outer Membrane Permeability Defects in Escherichia coli., J Bacteriol 200(2)

 [2] Schultz KM., Feix JB., Klug CS., 2013, Disruption of LptA oligomerization and affinity of the LptA-LptC interaction., Protein Sci 22(11):1639-45

 [3] Schultz KM., Fischer MA., Noey EL., Klug CS., 2018, Disruption of the E. coli LptC dimerization interface and characterization of lipopolysaccharide and LptA binding to monomeric LptC., Protein Sci 27(8):1407-1417

 [4] Schultz KM., Klug CS., 2017, High-pressure EPR spectroscopy studies of the E. coli lipopolysaccharide transport proteins LptA and LptC., Appl Magn Reson 48(11-12):1341-1353

 [5] Schultz KM., Lundquist TJ., Klug CS., 2017, Lipopolysaccharide binding to the periplasmic protein LptA., Protein Sci 26(8):1517-1523

 [6] Vetterli SU., Zerbe K., Muller M., Urfer M., Mondal M., Wang SY., Moehle K., Zerbe O., Vitale A., Pessi G., Eberl L., Wollscheid B., Robinson JA., 2018, Thanatin targets the intermembrane protein complex required for lipopolysaccharide transport in Escherichia coli., Sci Adv 4(11):eaau2634

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB