RegulonDB RegulonDB 10.9: Gene Form
   

mtgA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mtgA elbB yrbL npr arcZ arcB rapZ ArcA SoxR SoxS PhoP BasR terminator arcZp arcZp TSS_3529 TSS_3529 mtgAp4 mtgAp4 TSS_3528 (cluster) TSS_3528 (cluster) yrbLp yrbLp TSS_3527 TSS_3527

Gene      
Name: mtgA    Texpresso search in the literature
Synonym(s): ECK3197, G7668, b3208, mgt, yrbM
Genome position(nucleotides): 3349081 <-- 3349809 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.99
External database links:  
ASAP:
ABE-0010530
ECHOBASE:
EB2659
ECOLIHUB:
mtgA
OU-MICROARRAY:
b3208
STRING:
511145.b3208
COLOMBOS: mtgA


Product      
Name: peptidoglycan glycosyltransferase MtgA
Synonym(s): Mgt, MtgA, YrbM
Sequence: Get amino acid sequence Fasta Format
Cellular location: cell wall,inner membrane
Molecular weight: 27.342
Isoelectric point: 10.613
Motif(s):
 
Type Positions Sequence
19 -> 39 LMVVLAVFWGGGIALFSVAPV
60 -> 227 YVAHSDWVSMDQISPWMGLAVIAAEDQKFPEHWGFDVASIEKALAHNERNENRIRGASTISQQTAKNLFLWDGRSWVRKGLEAGLTLGIETVWSKKRILTVYLNIAEFGDGVFGVEAAAQRYFHKPASKLTRSEAALLAAVLPNPLRFKVSSPSGYVRSRQAWILRQM

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.6 - biosynthesis of macromolecules (cellular constituents) --> 1.6.7 - murein (peptidoglycan)
  6 - cell structure --> 6.2 - murein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
GO:0009274 - peptidoglycan-based cell wall
molecular_function GO:0005515 - protein binding
GO:0016757 - transferase activity, transferring glycosyl groups
GO:0016740 - transferase activity
GO:0016763 - transferase activity, transferring pentosyl groups
GO:0008955 - peptidoglycan glycosyltransferase activity
biological_process GO:0009252 - peptidoglycan biosynthetic process
GO:0043164 - Gram-negative-bacterium-type cell wall biogenesis
GO:0008360 - regulation of cell shape
GO:0071555 - cell wall organization
Note(s): Note(s): ...[more].
Reference(s): [1] Faure D., et al., 2004
[2] Spratt BG., et al., 1996
External database links:  
CAZY:
GT51
DIP:
DIP-10266N
ECOCYC:
G7668-MONOMER
ECOLIWIKI:
b3208
INTERPRO:
IPR036950
INTERPRO:
IPR001264
INTERPRO:
IPR011812
INTERPRO:
IPR023346
MODBASE:
P46022
PANTHER:
PTHR30400
PFAM:
PF00912
PRIDE:
P46022
PRODB:
PRO_000023302
REFSEQ:
NP_417675
SMR:
P46022
UNIPROT:
P46022


Operon      
Name: elbB-mtgA         
Operon arrangement:
Transcription unit        Promoter
elbB-mtgA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3527 3348325 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_3528 (cluster) 3348425 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter mtgAp4 3349831 reverse Similarity to the consensus
Read more >
[ICWHO] [4]
  promoter TSS_3529 3350497 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Faure D., Frederick R., Wloch D., Portier P., Blot M., Adams J., 2004, Genomic changes arising in long-term stab cultures of Escherichia coli., J Bacteriol 186(19):6437-42

 [2] Spratt BG., Zhou J., Taylor M., Merrick MJ., 1996, Monofunctional biosynthetic peptidoglycan transglycosylases., Mol Microbiol 19(3):639-40

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [4] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB