RegulonDB RegulonDB 10.8: Gene Form
   

yhcG gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yhcG yhcF yhcH unknown nanK TSS_3553 TSS_3553 TSS_3552 TSS_3552

Gene      
Name: yhcG    Texpresso search in the literature
Synonym(s): ECK3209, G7674, b3220
Genome position(nucleotides): 3367827 --> 3368954 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.38
External database links:  
ASAP:
ABE-0010567
ECHOBASE:
EB2664
OU-MICROARRAY:
b3220
PortEco:
yhcG
STRING:
511145.b3220
COLOMBOS: yhcG


Product      
Name: DUF1016 domain-containing protein YhcG
Synonym(s): YhcG
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 43.293
Isoelectric point: 6.912
Motif(s):
 
Type Positions Sequence
19 -> 184 IIHLVDSARTETVRSVNALMTATYQEIGRRIVEFEQGGEARAAYGAQLIKRLSKDLCLRYKRGFSAKNLRQMRLFYLFFQHVEIHQTMSGELTPLGIPQTPSAEFPSAKIWQTLSAKSFPLPRSTYVRLLSVKNADARSFYEKETLRCGWSVRQLERQIATQFYER
208 -> 360 QQAIRDPFVLEFLELKDEYSESDFEEALINHLMDFMLELGDDFAFVGRQRRLRIDDNWFRVDLLFFHRRLRCLLIVDLKVGKFSYSDAGQMNMYLNYAKEHWTLPDENPPIGLVLCAEKGAGEAHYALAGLPNTVLASEYKMQLPDEKRLADE

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0004518 - nuclease activity
GO:0016787 - hydrolase activity
biological_process GO:0090305 - nucleic acid phosphodiester bond hydrolysis
Note(s): Note(s): ...[more].
Evidence: [ICA] Inferred by computational analysis
Reference(s): [1] Kosinski J., et al., 2005
External database links:  
ECOCYC:
G7674-MONOMER
ECOLIWIKI:
b3220
INTERPRO:
IPR009362
INTERPRO:
IPR041527
PANTHER:
PTHR30547
PFAM:
PF17761
PFAM:
PF06250
PRIDE:
P45423
REFSEQ:
NP_417687
SMR:
P45423
UNIPROT:
P45423


Operon      
Name: yhcG         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3552 3367641 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3553 3367769 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kosinski J., Feder M., Bujnicki JM., 2005, The PD-(D/E)XK superfamily revisited: identification of new members among proteins involved in DNA metabolism and functional predictions for domains of (hitherto) unknown function., BMC Bioinformatics 6:172

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB