RegulonDB RegulonDB 10.8: Gene Form
   

nanR gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dcuD nanA nanR rpsI3\' PhoP IHF CRP Fis Fis NanR NanR NanR Fis dcuDp dcuDp nanRp9 nanRp9 nanRp10 nanRp10 dcuDp2 dcuDp2 nanAp nanAp

Gene      
Name: nanR    Texpresso search in the literature
Synonym(s): ECK3215, G7678, b3226, yhcK
Genome position(nucleotides): 3373698 <-- 3374489 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.27
External database links:  
ASAP:
ABE-0010584
ECHOBASE:
EB2668
OU-MICROARRAY:
b3226
PortEco:
nanR
STRING:
511145.b3226
COLOMBOS: nanR


Product      
Name: DNA-binding transcriptional dual regulator NanR
Synonym(s): NanR, YhcK
Sequence: Get amino acid sequence Fasta Format
Regulator Family: GntR
Cellular location: cytosol
Molecular weight: 29.524
Isoelectric point: 6.44
Motif(s):
 
Type Positions Sequence
30 -> 98 KKLSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGERARVSRP
32 -> 95 LSEMVEEELEQMIRRREFGEGEQLPSERELMAFFNVGRPSVREALAALKRKGLVQINNGERARV
125 -> 246 EQLRLFFESSLVRYAAEHATDEQIDLLAKALEINSQSLDNNAAFIRSDVDFHRVLAEIPGNPIFMAIHVALLDWLIAARPTVTDQALHEHNNVSYQQHIAIVDAIRRHDPDEADRALQSHLN
58 -> 77 ERELMAFFNVGRPSVREALA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.2 - Transcription related
  3 - regulation --> 3.1 - type of regulation --> 3.1.2 - transcriptional level --> 3.1.2.3 - repressor
  3 - regulation --> 3.3 - genetic unit regulated --> 3.3.1 - operon
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003677 - DNA binding
GO:0003700 - DNA-binding transcription factor activity
biological_process GO:0006351 - transcription, DNA-templated
GO:0006355 - regulation of transcription, DNA-templated
GO:0045892 - negative regulation of transcription, DNA-templated
Note(s): Note(s): ...[more].
Evidence: [APPH] Assay of protein purified to homogeneity
[IFC] Inferred by functional complementation
Reference(s): [1] Kalivoda KA., et al., 2003
External database links:  
DIP:
DIP-12284N
ECOCYC:
G7678-MONOMER
ECOLIWIKI:
b3226
INTERPRO:
IPR008920
INTERPRO:
IPR036390
INTERPRO:
IPR036388
INTERPRO:
IPR023730
INTERPRO:
IPR011711
INTERPRO:
IPR000524
MODBASE:
P0A8W0
PFAM:
PF00392
PFAM:
PF07729
PRIDE:
P0A8W0
PRINTS:
PR00035
PRODB:
PRO_000023344
PROSITE:
PS50949
REFSEQ:
NP_417693
SMART:
SM00895
SMART:
SM00345
SMR:
P0A8W0
UNIPROT:
P0A8W0


Operon      
Name: nanR         
Operon arrangement:
Transcription unit        Promoter
 


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter nanRp10 3374676 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter nanRp9 3374703 reverse Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Kalivoda KA., Steenbergen SM., Vimr ER., Plumbridge J., 2003, Regulation of sialic acid catabolism by the DNA binding protein NanR in Escherichia coli., J Bacteriol 185(16):4806-15

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB