RegulonDB RegulonDB 10.9: Gene Form
   

yhdT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

panF accC prmA yhdT terminator anti-anti-terminator anti-terminator TSS_3596 TSS_3596 TSS_3595 TSS_3595 TSS_3594 TSS_3594 TSS_3593 TSS_3593 TSS_3592 TSS_3592 TSS_3591 TSS_3591 yhdTp yhdTp

Gene      
Name: yhdT    Texpresso search in the literature
Synonym(s): ECK3244, G7693, b3257
Genome position(nucleotides): 3407375 --> 3407617 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.32
External database links:  
ASAP:
ABE-0010690
ECHOBASE:
EB2680
ECOLIHUB:
yhdT
OU-MICROARRAY:
b3257
STRING:
511145.b3257
COLOMBOS: yhdT


Product      
Name: DUF997 domain-containing protein YhdT
Synonym(s): YhdT
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 9.098
Isoelectric point: 4.838
Motif(s):
 
Type Positions Sequence
7 -> 77 QAHKEARWALGLTLLYLAVWLVAAYLSGVAPGFTGFPRWFEMACILTPLLFIGLCWAMVKFIYRDIPLEDD
15 -> 35 ALGLTLLYLAVWLVAAYLSGV
45 -> 65 WFEMACILTPLLFIGLCWAMV

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7693-MONOMER
ECOLIWIKI:
b3257
INTERPRO:
IPR010398
PANTHER:
PTHR39174
PFAM:
PF06196
PRIDE:
P45566
REFSEQ:
NP_417723
UNIPROT:
P45566


Operon      
Name: yhdT-panF-prmA         
Operon arrangement:
Transcription unit        Promoter
yhdT-panF-prmA


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3591 3408793 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3592 3408983 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3593 3409040 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3594 3409063 forward nd [RS-EPT-CBR] [1]
  promoter TSS_3595 3409159 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3596 3409381 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB