RegulonDB RegulonDB 10.9: Gene Form
   

yhdU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yhdJ envR yhdU yhdUp1 yhdUp1

Gene      
Name: yhdU    Texpresso search in the literature
Synonym(s): ECK3250, G7694, b3263
Genome position(nucleotides): 3412621 --> 3412800 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
40.56
External database links:  
ASAP:
ABE-0010710
ECHOBASE:
EB2681
ECOLIHUB:
yhdU
OU-MICROARRAY:
b3263
STRING:
511145.b3263
COLOMBOS: yhdU


Product      
Name: DUF2556 domain-containing protein YhdU
Synonym(s): YhdU
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 7.204
Isoelectric point: 4.8
Motif(s):
 
Type Positions Sequence
1 -> 53 MIRKYWWLVVFAVFVFLFDTLLMQWIELLATETDKCRNMNSVNPLKLVNCDEL
6 -> 26 WWLVVFAVFVFLFDTLLMQWI

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7694-MONOMER
ECOLIWIKI:
b3263
INTERPRO:
IPR022540
PFAM:
PF10831
PRIDE:
P64619
REFSEQ:
NP_417729
UNIPROT:
P64619


Operon      
Name: yhdU         
Operon arrangement:
Transcription unit        Promoter
yhdU


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yhdUp1 3412497 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB