RegulonDB RegulonDB 10.10: Gene Form
   

tusC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yheO tusD tusC tusB DksA-ppGpp DksA-ppGpp anti-anti-terminator tusBp7 tusBp7 TSS_3943 TSS_3943

Gene      
Name: tusC    Texpresso search in the literature
Synonym(s): ECK3331, G7713, b3344, yheM
Genome position(nucleotides): 3474973 <-- 3475332 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.28
External database links:  
ASAP:
ABE-0010928
ECHOBASE:
EB2734
ECOLIHUB:
yheM
OU-MICROARRAY:
b3344
STRING:
511145.b3344
COLOMBOS: tusC


Product      
Name: sulfurtransferase complex subunit TusC
Synonym(s): TusC, YheM
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 13.045
Isoelectric point: 4.469
Motif(s):
 
Type Positions Sequence
79 -> 79 C
76 -> 76 C
2 -> 119 KRIAFVFSTAPHGTAAGREGLDALLATSALTDDLAVFFIADGVFQLLPGQKPDAVLARDYIATFKLLGLYDIEQCWVCAASLRERGLDPQTPFVVEATPLEADALRRELANYDVILRF

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:1990228 - sulfurtransferase complex
GO:0005737 - cytoplasm
GO:0005829 - cytosol
biological_process GO:0008033 - tRNA processing
GO:0002143 - tRNA wobble position uridine thiolation
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12309N
ECOCYC:
G7713-MONOMER
ECOLIWIKI:
b3344
INTERPRO:
IPR037450
INTERPRO:
IPR027396
INTERPRO:
IPR003787
INTERPRO:
IPR017462
MODBASE:
P45531
PANTHER:
PTHR38780
PDB:
2D1P
PFAM:
PF02635
PRIDE:
P45531
PRODB:
PRO_000024145
REFSEQ:
NP_417803
SMR:
P45531
SWISSMODEL:
P45531
UNIPROT:
P45531


Operon      
Name: yheO-tusDCB         
Operon arrangement:
Transcription unit        Promoter
yheO-tusDCB
yheO-tusDCB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3943 3474800 reverse nd [RS-EPT-CBR] [1]
  promoter tusBp7 3475109 reverse nd [ICWHO] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB