RegulonDB RegulonDB 10.9: Gene Form
   

yheO gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fkpA yheO tusD tusC anti-anti-terminator anti-terminator terminator TSS_3945 TSS_3945 TSS_3944 TSS_3944 yheOp2 yheOp2 yheOp1 yheOp1 tusBp7 tusBp7

Gene      
Name: yheO    Texpresso search in the literature
Synonym(s): ECK3333, G7715, b3346
Genome position(nucleotides): 3475718 <-- 3476440 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
47.3
External database links:  
ASAP:
ABE-0010936
ECHOBASE:
EB2736
ECOLIHUB:
yheO
OU-MICROARRAY:
b3346
STRING:
511145.b3346
COLOMBOS: yheO


Product      
Name: DNA-binding transcriptional regulator YheO
Synonym(s): YheO
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.821
Isoelectric point: 5.347
Motif(s):
 
Type Positions Sequence
29 -> 137 LKSYEAVVDGLAMLIGSHCEIVLHSLQDLKCSAIRIANGEHTGRKIGSPITDLALRMLHDMTGADSSVSKCYFTRAKSGVLMKSLTIAIRNREQRVIGLLCINMNLDVP
171 -> 228 LEFTIEEVNADRNVSNNAKNRQIVLNLYEKGIFDIKDAINQVADRLNISKHTVYLYIR

 

Classification:
Multifun Terms (GenProtEC)  
  3 - regulation --> 3.1 - type of regulation --> 3.1.4 - unknown
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
Note(s): Note(s): ...[more].
Evidence: [AIFS] Automated inference of function from sequence
[IPI] Inferred from physical interaction
Reference(s): [1] Gao Y., et al., 2018
[2] Perez-Rueda E., et al., 2004
External database links:  
DIP:
DIP-12311N
ECOCYC:
G7715-MONOMER
ECOLIWIKI:
b3346
INTERPRO:
IPR039446
INTERPRO:
IPR039445
INTERPRO:
IPR013559
PANTHER:
PTHR35568
PFAM:
PF13309
PFAM:
PF08348
PRIDE:
P64624
REFSEQ:
NP_417805
SMR:
P64624
UNIPROT:
P64624


Operon      
Name: yheO-tusDCB         
Operon arrangement:
Transcription unit        Promoter
yheO-tusDCB
yheO-tusDCB


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter tusBp7 3475109 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter TSS_3944 3477222 reverse nd [RS-EPT-CBR] [4]
  promoter TSS_3945 3477356 reverse nd [RS-EPT-CBR] [4]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Gao Y., Yurkovich JT., Seo SW., Kabimoldayev I., Drager A., Chen K., Sastry AV., Fang X., Mih N., Yang L., Eichner J., Cho BK., Kim D., Palsson BO., 2018, Systematic discovery of uncharacterized transcription factors in Escherichia coli K-12 MG1655., Nucleic Acids Res 46(20):10682-10696

 [2] Perez-Rueda E., Collado-Vides J., Segovia L., 2004, Phylogenetic distribution of DNA-binding transcription factors in bacteria and archaea., Comput Biol Chem 28(5-6):341-50

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [4] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB