RegulonDB RegulonDB 10.9: Gene Form
   

yhfK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yhfK argD crp TSS_3961 (cluster) TSS_3961 (cluster) TSS_3960 (cluster) TSS_3960 (cluster) TSS_3959 TSS_3959

Gene      
Name: yhfK    Texpresso search in the literature
Synonym(s): ECK3346, G7721, b3358
Genome position(nucleotides): 3486791 --> 3488893 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.78
External database links:  
ASAP:
ABE-0010974
ECHOBASE:
EB2743
ECOLIHUB:
yhfK
OU-MICROARRAY:
b3358
STRING:
511145.b3358
COLOMBOS: yhfK


Product      
Name: putative transporter YhfK
Synonym(s): YhfK
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 79.972
Isoelectric point: 9.238
Motif(s):
 
Type Positions Sequence
115 -> 135 LLPASLLAAIFTLSLAGYMPV
381 -> 502 ASLMGTALHLPKSYWILMTVLLVTQNGYGATRLRIVNRSVGTVVGLIIAGVALHFKIPEGYTLTLMLITTLASYLILRKNYGWATVGFTITAVYTLQLLWLNGEQYILPRLIDTIIGCLIAF
67 -> 334 LIIGASLFATCSLLTQLLLAKDVPLPFLLTGLTLVLGVTAELGPLHAKLLPASLLAAIFTLSLAGYMPVWEPLLIYALGTLWYGLFNWFWFWIWREQPLRESLSLLYRELADYCEAKYSLLTQHTDPEKALPPLLVRQQKAVDLITQCYQQMHMLSAQNNTDYKRMLRIFQEALDLQEHISVSLHQPEEVQKLVERSHAEEVIRWNAQTVAARLRVLADDILYHRLPTRFTMEKQIGALEKIARQHPDNPVGQFCYWHFSRIARVLRT
420 -> 440 VGTVVGLIIAGVALHFKIPEG
383 -> 403 LMGTALHLPKSYWILMTVLLV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
biological_process GO:0055085 - transmembrane transport
Note(s): Note(s): ...[more].
Reference(s): [1] Jindal S., et al., 2019
[2] Paradis-Bleau C., et al., 2014
External database links:  
ECOCYC:
G7721-MONOMER
ECOLIWIKI:
b3358
INTERPRO:
IPR032692
INTERPRO:
IPR010020
PFAM:
PF12805
PFAM:
PF13515
PRIDE:
P45537
REFSEQ:
NP_417817
SMR:
P45537
UNIPROT:
P45537


Operon      
Name: yhfK         
Operon arrangement:
Transcription unit        Promoter
yhfK


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3959 3486595 forward nd [RS-EPT-CBR] [3]
  promoter TSS_3960 (cluster) 3486615 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_3961 (cluster) 3486621 forward For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Jindal S., Yang L., Day PJ., Kell DB., 2019, Involvement of multiple influx and efflux transporters in the accumulation of cationic fluorescent dyes by Escherichia coli., BMC Microbiol 19(1):195

 [2] Paradis-Bleau C., Kritikos G., Orlova K., Typas A., Bernhardt TG., 2014, A genome-wide screen for bacterial envelope biogenesis mutants identifies a novel factor involved in cell wall precursor metabolism., PLoS Genet 10(1):e1004056

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB