RegulonDB RegulonDB 11.1: Gene Form
   

yhfL gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cysG frlA yhfL FrlR CRP frlAp1 frlAp1 frlAp5 frlAp5 frlAp17 frlAp17 yhfLp4 yhfLp4 yhfLp8 yhfLp8 yhfLp7 yhfLp7 yhfLp5 yhfLp5

Gene      
Name: yhfL    Texpresso search in the literature
Synonym(s): ECK3357, G7722, b3369
Genome position(nucleotides): 3499448 --> 3499615
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
42.26
External database links:  
ASAP:
ABE-0011016
ECHOBASE:
EB2744
ECOLIHUB:
yhfL
OU-MICROARRAY:
b3369
STRING:
511145.b3369
COLOMBOS: yhfL


Product      
Name: DUF4223 domain-containing lipoprotein YhfL
Synonym(s): YhfL
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 5.819
Isoelectric point: 8.507
Motif(s):
 
Type Positions Sequence Comment
1 -> 54 MNKFIKVALVGAVLATLTACTGHIENRDKNCSYDYLLHPAISISKIIGGCGPTA
7 -> 24 VALVGAVLATLTACTGHI UniProt: Helical.

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
Reference(s): [1] Gonnet P., et al., 2004
External database links:  
ALPHAFOLD:
P64627
ECOCYC:
G7722-MONOMER
ECOLIWIKI:
b3369
INTERPRO:
IPR025318
PFAM:
PF13978
PRIDE:
P64627
REFSEQ:
NP_417828
UNIPROT:
P64627


Operon      
Name: yhfL         
Operon arrangement:
Transcription unit        Promoter
yhfL


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yhfLp5 3499311 forward nd [COMP-AINF] [2]
  promoter yhfLp7 3499413 forward nd [COMP-AINF] [2]
  promoter yhfLp8 3499433 forward nd [COMP-AINF] [2]
  promoter yhfLp4 3499438 forward nd [COMP-AINF] [2]
  promoter frlAp17 3499759 forward nd [COMP-AINF], [EXP-IMP] [2], [3]
  promoter frlAp5 3499770 forward nd [COMP-AINF], [EXP-IMP] [2], [3]


Evidence    

 [COMP-AINF] Inferred computationally without human oversight

 [EXP-IMP] Inferred from mutant phenotype



Reference(s)    

 [1] Gonnet P., Rudd KE., Lisacek F., 2004, Fine-tuning the prediction of sequences cleaved by signal peptidase II: a curated set of proven and predicted lipoproteins of Escherichia coli K-12., Proteomics 4(6):1597-613

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Graf von Armansperg B., Koller F., Gericke N., Hellwig M., Jagtap PKA., Heermann R., Hennig J., Henle T., Lassak J., 2021, Transcriptional regulation of the Nε -fructoselysine metabolism in Escherichia coli by global and substrate-specific cues., Mol Microbiol 115(2):175-190


RegulonDB