RegulonDB RegulonDB 10.9: Gene Form
   

yhhY gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yhhZ yhhY ryhB Fur Fur Fur yhhZp7 yhhZp7 yhhZp5 yhhZp5 yhhYp yhhYp yhhXp5 yhhXp5

Gene      
Name: yhhY    Texpresso search in the literature
Synonym(s): ECK3427, G7758, b3441
Genome position(nucleotides): 3581138 --> 3581626 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.74
External database links:  
ASAP:
ABE-0011240
ECHOBASE:
EB2779
ECOLIHUB:
yhhY
OU-MICROARRAY:
b3441
STRING:
511145.b3441
COLOMBOS: yhhY


Product      
Name: N-acetyltransferase YhhY
Synonym(s): YhhY
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 18.794
Isoelectric point: 7.541
Motif(s):
 
Type Positions Sequence
4 -> 162 IVIRHAETRDYEAIRQIHAQPEVYCNTLQVPHPSDHMWQERLADRPGIKQLVACIDGDVVGHLTIDVQQRPRRSHVADFGICVDSRWKNRGVASALMREMIEMCDNWLRVDRIELTVFVDNAPAIKVYKKYGFEIEGTGKKYALRNGEYVDAYYMARVK
34 -> 136 PHPSDHMWQERLADRPGIKQLVACIDGDVVGHLTIDVQQRPRRSHVADFGICVDSRWKNRGVASALMREMIEMCDNWLRVDRIELTVFVDNAPAIKVYKKYGF

 

Classification:
Multifun Terms (GenProtEC)  
  5 - cell processes --> 5.6 - protection --> 5.6.2 - detoxification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0050176 - phenylalanine N-acetyltransferase activity
GO:0016740 - transferase activity
GO:0008080 - N-acetyltransferase activity
GO:0016746 - transferase activity, transferring acyl groups
GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups
Note(s): Note(s): ...[more].
Evidence: [IDA] Inferred from direct assay
Reference(s): [1] Kazakov T., et al., 2014
External database links:  
ECOCYC:
G7758-MONOMER
ECOLIWIKI:
b3441
INTERPRO:
IPR000182
INTERPRO:
IPR016181
MODBASE:
P46854
PFAM:
PF00583
PRIDE:
P46854
PROSITE:
PS51186
REFSEQ:
NP_417898
SMR:
P46854
UNIPROT:
P46854


Operon      
Name: yhhY         
Operon arrangement:
Transcription unit        Promoter
yhhY


Transcriptional Regulation      
Display Regulation             
Repressed by: Fur


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yhhZp5 3581758 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter yhhZp7 3581841 forward Similarity to the consensus
Read more >
[ICWHO] [2]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Kazakov T., Kuznedelov K., Semenova E., Mukhamedyarov D., Datsenko KA., Metlitskaya A., Vondenhoff GH., Tikhonov A., Agarwal V., Nair S., Van Aerschot A., Severinov K., 2014, The RimL transacetylase provides resistance to translation inhibitor microcin C., J Bacteriol 196(19):3377-85

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB