RegulonDB RegulonDB 10.9: Gene Form
   

insJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insJK insK insJ mokA hokA sokA ysaE TSS_4162 TSS_4162 insKp insKp hokAp6 hokAp6 insJp4 insJp4

Gene      
Name: insJ    Texpresso search in the literature
Synonym(s): ECK3545, G7776, b3557, yi5A
Genome position(nucleotides): 3720680 --> 3721201 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
46.17
Note(s): Note that the spliced sequence refers to the effective coding sequence following regulatory frameshifting, as
described in the protein comments.
External database links:  
ASAP:
ABE-0011620
ECHOBASE:
EB4746
ECOLIHUB:
insJ
OU-MICROARRAY:
b3557
STRING:
511145.b3557
COLOMBOS: insJ


Product      
Name: insertion element IS150 protein InsA
Synonym(s): IS150 protein InsA, InsJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 19.725
Isoelectric point: 10.672
Motif(s):
 
Type Positions Sequence
68 -> 114 RIKVVKAVIEQHMSLNQAAAHFMLAGSGSVARWLKVYEERGEAGLRA
10 -> 59 KRLEVVNHYFTTDDGYRIISARFGVPRTQVRTWVALYEKHGEKGLIPKPK

 

Classification:
Multifun Terms (GenProtEC)  
  8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0043565 - sequence-specific DNA binding
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Haas M., et al., 2002
External database links:  
ECOCYC:
G7776-MONOMER
ECOLIWIKI:
b3557
INTERPRO:
IPR010921
PFAM:
PF13518
PRIDE:
P19768
REFSEQ:
NP_418014
SMR:
P19768
UNIPROT:
P19768


Operon      
Name: insJ         
Operon arrangement:
Transcription unit        Promoter
insJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter insJp4 3720594 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter hokAp6 3720810 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_4162 3721864 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4163 3722550 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4164 (cluster) 3723367 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4165 3723961 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4166 (cluster) 3724383 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Haas M., Rak B., 2002, Escherichia coli insertion sequence IS150: transposition via circular and linear intermediates., J Bacteriol 184(21):5833-41

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB