RegulonDB RegulonDB 10.9: Gene Form
   

ysgA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

metE ysgA udp CRP CytR CytR CytR CRP anti-terminator anti-anti-terminator TSS_4507 TSS_4507 TSS_4506 TSS_4506 TSS_4505 TSS_4505 TSS_4504 TSS_4504 udpP udpP TSS_4503 (cluster) TSS_4503 (cluster) ysgAp ysgAp TSS_4502 TSS_4502 TSS_4501 TSS_4501 TSS_4500 TSS_4500 TSS_4499 TSS_4499 TSS_4498 TSS_4498 TSS_4497 TSS_4497 TSS_4496 TSS_4496 TSS_4495 TSS_4495 TSS_4494 TSS_4494 TSS_4493 TSS_4493 TSS_4492 TSS_4492 TSS_4491 TSS_4491 TSS_4490 TSS_4490

Gene      
Name: ysgA    Texpresso search in the literature
Synonym(s): ECK3824, G7804, b3830
Genome position(nucleotides): 4015354 <-- 4016169 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.53
External database links:  
ASAP:
ABE-0012522
ECHOBASE:
EB4067
ECOLIHUB:
ysgA
OU-MICROARRAY:
b3830
STRING:
511145.b3830
COLOMBOS: ysgA


Product      
Name: putative dienelactone hydrolase
Synonym(s): YsgA
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 29.425
Isoelectric point: 5.83
Motif(s):
 
Type Positions Sequence
42 -> 265 MPAYHARPKQSDGPLPVVIVVQEIFGVHEHIRDICRRLALEGYLAIAPELYFREGDPNDFADIPTLLSGLVAKVPDSQVLADLDHVASWASRNGGDVHRLMITGFCWGGRITWLYAAHNPQLKAAVAWYGKLTGDKSLNSPKQPVDIATDLNAPILGLYGGQDNSIPQESVETMRQALRAANAKAEIIVYPDAGHAFNADYRPSYHAASAEDGWQRMLEWFKQY

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0016787 - hydrolase activity
GO:0008806 - carboxymethylenebutenolidase activity
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-12929N
ECOCYC:
G7804-MONOMER
ECOLIWIKI:
b3830
INTERPRO:
IPR002925
INTERPRO:
IPR029058
MODBASE:
P56262
PFAM:
PF01738
PRIDE:
P56262
REFSEQ:
YP_026268
SMR:
P56262
UNIPROT:
P56262


Operon      
Name: ysgA         
Operon arrangement:
Transcription unit        Promoter
ysgA


Transcriptional Regulation      
Display Regulation             
Repressed by: FNR


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4490 4013061 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4491 4013079 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4492 4013127 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4493 4013584 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4494 4013877 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4495 4013894 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4496 4013905 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4497 4013974 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4498 4014376 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4499 4014407 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4500 4014445 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4501 4014468 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_4502 4015162 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4503 (cluster) 4016386 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_4504 4016393 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4505 4016395 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4506 4016397 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4507 4016404 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB