RegulonDB RegulonDB 10.10: Gene Form
   

yjdF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

fumB melB yjdF

Gene      
Name: yjdF    Texpresso search in the literature
Synonym(s): ECK4114, G7825, b4121
Genome position(nucleotides): 4344929 <-- 4345558 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.92
External database links:  
ASAP:
ABE-0013498
ECHOBASE:
EB2356
ECOLIHUB:
yjdF
OU-MICROARRAY:
b4121
STRING:
511145.b4121
COLOMBOS: yjdF


Product      
Name: DUF2238 domain-containing inner membrane protein YjdF
Synonym(s): YjdF
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 23.442
Isoelectric point: 8.887
Motif(s):
 
Type Positions Sequence
8 -> 28 LILNTSALTLTLILIYTGISA
56 -> 76 PLTPLLYTLIFLHAIILMVGG
132 -> 152 VAFLVCCVALAISAMYELIEW
32 -> 52 LTWLMEVTPVIIVVQLLLATA
42 -> 182 IIVVQLLLATARRYPLTPLLYTLIFLHAIILMVGGQYTYAKVPVGFEVQEWLGLSRNPYDKLGHFFQGLVPALVAREILVRGMYVRGRKMVAFLVCCVALAISAMYELIEWWAALAMGQGADDFLGTQGDQWDTQSDMFCA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7825-MONOMER
ECOLIWIKI:
b4121
INTERPRO:
IPR014509
PFAM:
PF09997
PRIDE:
P39270
REFSEQ:
NP_418545
UNIPROT:
P39270


Operon      
Name: yjdF         
Operon arrangement:
Transcription unit        Promoter
yjdF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB