RegulonDB RegulonDB 10.9: Gene Form
   

yjdI gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

dcuS yjdJ yjdI dcuR NarL NarL CRP TSS_4928 TSS_4928 TSS_4927 TSS_4927 dcuSp dcuSp dcuRp dcuRp

Gene      
Name: yjdI    Texpresso search in the literature
Synonym(s): ECK4119, G7828, b4126
Genome position(nucleotides): 4351843 --> 4352073 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.92
External database links:  
ASAP:
ABE-0013513
ECHOBASE:
EB2359
ECOLIHUB:
yjdI
OU-MICROARRAY:
b4126
STRING:
511145.b4126
COLOMBOS: yjdI


Product      
Name: PF06902 family protein YjdI
Synonym(s): YjdI
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 8.55
Isoelectric point: 8.639
Motif(s):
 
Type Positions Sequence
13 -> 76 YTGEKIDVYFNTAICQHSGNCVRGNGKLFNLKRKPWIMPDEVDVATVVKVIDTCPSGALKYRHK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-48210N
ECOCYC:
G7828-MONOMER
ECOLIWIKI:
b4126
INTERPRO:
IPR010693
PFAM:
PF06902
PRIDE:
P0AF59
REFSEQ:
NP_418550
SMR:
P0AF59
UNIPROT:
P0AF59


Operon      
Name: yjdIJ         
Operon arrangement:
Transcription unit        Promoter
yjdIJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4927 4351813 forward nd [RS-EPT-CBR] [1]
  promoter TSS_4928 4352176 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB