RegulonDB RegulonDB 10.10: Gene Form
   

blc gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

ampC blc gdx ecnB Cis-reg anti-anti-terminator anti-terminator terminator terminator blcp blcp TSS_4966 TSS_4966 sugEp sugEp

Gene      
Name: blc    Texpresso search in the literature
Synonym(s): ECK4145, G7837, b4149, yjeL
Genome position(nucleotides): 4377189 <-- 4377722 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.37
External database links:  
ASAP:
ABE-0013590
ECHOBASE:
EB2367
ECOLIHUB:
blc
OU-MICROARRAY:
b4149
STRING:
511145.b4149
COLOMBOS: blc


Shine dalgarno      
Sequence: aaaaaccagtAAGGAAacattTAT


Product      
Name: outer membrane lipoprotein Blc
Synonym(s): Blc, YjeL, outer membrane lipoprotein (lipocalin)
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol,outer membrane
Molecular weight: 19.852
Isoelectric point: 9.004
Motif(s):
 
Type Positions Sequence
41 -> 48 GTWYEIAR
112 -> 121 FYGGYNVIAL
72 -> 80 LNVINKGYN
103 -> 109 ALKVSFF
19 -> 177 CSSPTPPRGVTVVNNFDAKRYLGTWYEIARFDHRFERGLEKVTATYSLRDDGGLNVINKGYNPDRGMWQQSEGKAYFTGAPTRAALKVSFFGPFYGGYNVIALDREYRHALVCGPDRDYLWILSRTPTISDEVKQEMLAVATREGFDVSKFIWVQQPGS

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0009279 - cell outer membrane
GO:0016020 - membrane
GO:0036406 - anchored component of periplasmic side of cell outer membrane
molecular_function GO:0008289 - lipid binding
biological_process GO:0006629 - lipid metabolic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0000302 - response to reactive oxygen species
Note(s): Note(s): ...[more].
Reference(s): [1] Bishop RE. 2000
[2] Gonnet P., et al., 2004
[3] Juncker AS., et al., 2003
[4] Rao S., et al., 2020
[5] Zou D., et al., 2020
External database links:  
DIP:
DIP-35862N
ECOCYC:
G7837-MONOMER
ECOLIWIKI:
b4149
INTERPRO:
IPR022272
INTERPRO:
IPR022271
INTERPRO:
IPR000566
INTERPRO:
IPR002446
INTERPRO:
IPR012674
MODBASE:
P0A901
PDB:
3MBT
PDB:
2ACO
PDB:
1QWD
PFAM:
PF08212
PRIDE:
P0A901
PRINTS:
PR01171
PRODB:
PRO_000022228
PROSITE:
PS00213
PROSITE:
PS51257
REFSEQ:
NP_418573
SMR:
P0A901
UNIPROT:
P0A901


Operon      
Name: blc         
Operon arrangement:
Transcription unit        Promoter
blc


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4966 4376799 forward nd [RS-EPT-CBR] [6]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Bishop RE., 2000, The bacterial lipocalins., Biochim Biophys Acta 1482(1-2):73-83

 [2] Gonnet P., Rudd KE., Lisacek F., 2004, Fine-tuning the prediction of sequences cleaved by signal peptidase II: a curated set of proven and predicted lipoproteins of Escherichia coli K-12., Proteomics 4(6):1597-613

 [3] Juncker AS., Willenbrock H., Von Heijne G., Brunak S., Nielsen H., Krogh A., 2003, Prediction of lipoprotein signal peptides in Gram-negative bacteria., Protein Sci 12(8):1652-62

 [4] Rao S., Bates GT., Matthews CR., Newport TD., Vickery ON., Stansfeld PJ., 2020, Characterizing Membrane Association and Periplasmic Transfer of Bacterial Lipoproteins through Molecular Dynamics Simulations., Structure 28(4):475-487.e3

 [5] Zou D., Pei J., Lan J., Sang H., Chen H., Yuan H., Wu D., Zhang Y., Wang Y., Wang D., Zou Y., Chen D., Ren J., Gao X., Lin Z., 2020, A SNP of bacterial blc disturbs gut lysophospholipid homeostasis and induces inflammation through epithelial barrier disruption., EBioMedicine 52:102652

 [6] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB