RegulonDB RegulonDB 11.0: Gene Form
   

rlmB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rnr rlmB yjfI TSS_5052 TSS_5052 TSS_5051 TSS_5051 TSS_5050 (cluster) TSS_5050 (cluster) TSS_5049 TSS_5049 TSS_5048 TSS_5048

Gene      
Name: rlmB    Texpresso search in the literature
Synonym(s): ECK4176, G7845, b4180, yjfH
Genome position(nucleotides): 4409275 --> 4410006
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.28
External database links:  
ASAP:
ABE-0013684
ECHOBASE:
EB2376
ECOLIHUB:
rlmB
OU-MICROARRAY:
b4180
STRING:
511145.b4180
COLOMBOS: rlmB


Product      
Name: 23S rRNA 2'-O-ribose G2251 methyltransferase
Synonym(s): RlmB, YjfH
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 26.557
Isoelectric point: 6.634
Motif(s):
 
Type Positions Sequence Comment
5 -> 78 IYGIHAVQALLERAPERFQEVFILKGREDKRLLPLIHALESQGVVIQLANRQYLDEKSDGAVHQGIIARVKPGR
96 -> 236 FLLILDGVTDPHNLGACLRSADAAGVHAVIVPKDRSAQLNATAKKVACGAAESVPLIRVTNLARTMRMLQEENIWIVGTAGEADHTLYQSKMTGRLALVMGAEGEGMRRLTREHCDELISIPMAGSVSSLNVSVATGICLF

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0008173 - RNA methyltransferase activity
GO:0003723 - RNA binding
GO:0070039 - rRNA (guanosine-2'-O-)-methyltransferase activity
biological_process GO:0001510 - RNA methylation
GO:0006396 - RNA processing
GO:0006364 - rRNA processing
GO:0032259 - methylation
GO:0000453 - enzyme-directed rRNA 2'-O-methylation
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P63177
DIP:
DIP-47866N
ECOCYC:
G7845-MONOMER
ECOLIWIKI:
b4180
INTERPRO:
IPR004441
INTERPRO:
IPR001537
INTERPRO:
IPR024915
INTERPRO:
IPR029026
INTERPRO:
IPR029064
INTERPRO:
IPR029028
INTERPRO:
IPR013123
MODBASE:
P63177
PANTHER:
PTHR46429
PDB:
1GZ0
PFAM:
PF00588
PFAM:
PF08032
PRIDE:
P63177
PRODB:
PRO_000023766
REFSEQ:
NP_418601
SMART:
SM00967
SMR:
P63177
UNIPROT:
P63177


Operon      
Name: nsrR-rnr-rlmB-yjfIJ         
Operon arrangement:
Transcription unit        Promoter
nsrR-rnr-rlmB-yjfI
yjfIJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5048 4406668 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5049 4406974 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5050 (cluster) 4407052 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5051 4407074 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5052 4409223 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB