RegulonDB RegulonDB 10.10: Gene Form
   

yjfM gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjfC yjfM yjfL AidB Ada

Gene      
Name: yjfM    Texpresso search in the literature
Synonym(s): ECK4181, G7850, b4185
Genome position(nucleotides): 4412387 --> 4413025 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
48.98
External database links:  
ASAP:
ABE-0013696
ECHOBASE:
EB2381
ECOLIHUB:
yjfM
OU-MICROARRAY:
b4185
STRING:
511145.b4185
COLOMBOS: yjfM


Product      
Name: DUF1190 domain-containing protein YjfM
Synonym(s): YjfM
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 23.352
Isoelectric point: 9.736
Motif(s):
 
Type Positions Sequence
69 -> 211 TFYATVQDCIDDGNNADICARGWNNAKTAFYADVPKNMTQQNCQSKYENCYYDNVEQSWIPVVSGFLLSRVIRKDRDEPFVYNSGGSSFASRPVWRSTSGDYSWRSGSGKKESYSSGGFTTKKASTVSRGGYGRSSSARGHWG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7850-MONOMER
ECOLIWIKI:
b4185
INTERPRO:
IPR009576
PFAM:
PF06693
PRIDE:
P39295
REFSEQ:
NP_418606
UNIPROT:
P39295


Operon      
Name: yjfKLMC         
Operon arrangement:
Transcription unit        Promoter
yjfKLMC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB