RegulonDB RegulonDB 11.0: Gene Form
   

yjiJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjiJ yjiK kptA yjiJp4 yjiJp4

Gene      
Name: yjiJ    Texpresso search in the literature
Synonym(s): ECK4323, G7929, b4332
Genome position(nucleotides): 4561497 <-- 4562675
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.52
External database links:  
ASAP:
ABE-0014206
ECHOBASE:
EB2459
ECOLIHUB:
yjiJ
OU-MICROARRAY:
b4332
STRING:
511145.b4332
COLOMBOS: yjiJ


Product      
Name: putative transporter YjiJ
Synonym(s): YjiJ
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 41.361
Isoelectric point: 9.619
Motif(s):
 
Type Positions Sequence Comment
13 -> 33 FSTALFGMLVLTLGMGLGRFL UniProt: Helical.
23 -> 380 LTLGMGLGRFLYTPMLPVMMAEGSFSFSQLSWIASGNYAGYLAGSLLFSFGAFHQPSRLRPFLLASALASGLLILAMAWLPPFILVLLIRVLAGVASAGMLIFGSTLIMQHTRHPFVLAALFSGVGIGIALGNEYVLAGLHFDLSSQTLWQGAGALSGMMLIALTLLMPSKKHAITPMPLAKTEQQIMSWWLLAILYGLAGFGYIIVATYLPLMAKDAGSPLLTAHLWTLVGLSIVPGCFGWLWAAKRWGALPCLTANLLVQAICVLLTLASDSPLLLIISSLGFGGTFMGTTSLVMTIARQLSVPGNLNLLGFVTLIYGIGQILGPALTSMLSNGTSALASATLCGAAALFIAALIS
55 -> 75 IASGNYAGYLAGSLLFSFGAF UniProt: Helical.
91 -> 111 ASGLLILAMAWLPPFILVLLI UniProt: Helical.
113 -> 133 VLAGVASAGMLIFGSTLIMQH UniProt: Helical.

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.B - Putative uncharacterized transport protein
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0016021 - integral component of membrane
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P39381
ECOCYC:
G7929-MONOMER
ECOLIWIKI:
b4332
INTERPRO:
IPR036259
INTERPRO:
IPR010645
MODBASE:
P39381
PFAM:
PF06779
PRIDE:
P39381
REFSEQ:
NP_418752
UNIPROT:
P39381


Operon      
Name: yjiJ         
Operon arrangement:
Transcription unit        Promoter
yjiJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjiJp4 4562682 reverse nd [ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB