RegulonDB RegulonDB 10.9: Gene Form
   

lgoD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

opgB lgoD lgoR CRP UxuR ExuR terminator TSS_5155 TSS_5155 lgoRp4 lgoRp4

Gene      
Name: lgoD    Texpresso search in the literature
Synonym(s): ECK4348, G7945, b4358, yjjN
Genome position(nucleotides): 4595990 --> 4597012 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.83
External database links:  
ASAP:
ABE-0014294
ECHOBASE:
EB2475
ECOLIHUB:
yjjN
OU-MICROARRAY:
b4358
STRING:
511145.b4358
COLOMBOS: lgoD


Product      
Name: L-galactonate oxidoreductase
Synonym(s): LgoD, YjjN
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 36.448
Isoelectric point: 6.415
Motif(s):
 
Type Positions Sequence
28 -> 133 NEALIKIKSVGICGTDIHAWGGNQPFFSYPRVLGHEICGEIVGLGKNIADLKNGQQVAVIPYVACQQCPACKSGRTNCCEKISVIGVHQDGGFSEYLSVPVANILP
173 -> 300 PIGLGAAAIAKADGAQVVVADTSPARREHVATRLELPLLDPSAEDFDAQLRAQFGGSLAQKVIDATGNQHAMNNTVNLIRHGGTVVFVGLFKGELQFSDPEFHKKETTMMGSRNATPEDFAKVGRLMA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0008270 - zinc ion binding
biological_process GO:0034195 - L-galactonate catabolic process
GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
[IEP] Inferred from expression pattern
[IMP] Inferred from mutant phenotype
Reference(s): [1] Kuivanen J., et al., 2014
[2] Reed JL., et al., 2006
External database links:  
ECOCYC:
G7945-MONOMER
ECOLIWIKI:
b4358
INTERPRO:
IPR013154
INTERPRO:
IPR036291
INTERPRO:
IPR020843
INTERPRO:
IPR013149
INTERPRO:
IPR011032
INTERPRO:
IPR002328
MODBASE:
P39400
PFAM:
PF08240
PFAM:
PF00107
PRIDE:
P39400
PROSITE:
PS00059
REFSEQ:
NP_418778
SMART:
SM00829
SMR:
P39400
UNIPROT:
P39400


Operon      
Name: lgoD         
Operon arrangement:
Transcription unit        Promoter
yjjN


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5155 4597417 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kuivanen J., Richard P., 2014, The yjjN of E. coli codes for an L-galactonate dehydrogenase and can be used for quantification of L-galactonate and L-gulonate., Appl Biochem Biotechnol 173(7):1829-35

 [2] Reed JL., Patel TR., Chen KH., Joyce AR., Applebee MK., Herring CD., Bui OT., Knight EM., Fong SS., Palsson BO., 2006, Systems approach to refining genome annotation., Proc Natl Acad Sci U S A 103(46):17480-4

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB