RegulonDB RegulonDB 10.9: Gene Form
   

rsmC gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rsmC holD leuQ rimI Fis rsmCp1 rsmCp1 holDp holDp rsmCp3 rsmCp3 leuQp leuQp

Gene      
Name: rsmC    Texpresso search in the literature
Synonym(s): ECK4362, G7950, b4371, yjjT
Genome position(nucleotides): 4606669 <-- 4607700 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.72
External database links:  
ASAP:
ABE-0014336
ECHOBASE:
EB2481
ECOLIHUB:
rsmC
OU-MICROARRAY:
b4371
STRING:
511145.b4371
COLOMBOS: rsmC


Product      
Name: 16S rRNA m2G1207 methyltransferase
Synonym(s): RsmC, YjjT, ribosomal RNA small subunit methyltransferase C
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 37.625
Isoelectric point: 6.427
Motif(s):
 
Type Positions Sequence
227 -> 227 D
88 -> 88 K
268 -> 268 N
2 -> 343 SAFTPASEVLLRHSDDFEQSRILFAGDLQDDLPARLDTAASRAHTQQFHHWQVLSRQMGDNARFSLVATADDVADCDTLIYYWPKNKPEAQFQLMNLLSLLPVGTDIFVVGENRSGVRSAEQMLADYAPLNKVDSARRCGLYFGRLEKQPVFDAEKFWGEYSVDGLTVKTLPGVFSRDGLDVGSQLLLSTLTPHTKGKVLDVGCGAGVLSVAFARHSPKIRLTLCDVSAPAVEASRATLAANGVEGEVFASNVFSEVKGRFDMIISNPPFHDGMQTSLDAAQTLIRGAVRHLNSGGELRIVANAFLPYPDVLDETFGFHEVIAQTGRFKVYRAIMTRQAKKG
86 -> 86 K

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.2 - RNA related --> 2.2.3 - RNA modification
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0003676 - nucleic acid binding
GO:0008168 - methyltransferase activity
GO:0016740 - transferase activity
GO:0008649 - rRNA methyltransferase activity
GO:0008990 - rRNA (guanine-N2-)-methyltransferase activity
GO:0052914 - 16S rRNA (guanine(1207)-N(2))-methyltransferase activity
biological_process GO:0031167 - rRNA methylation
GO:0006364 - rRNA processing
GO:0032259 - methylation
GO:0070475 - rRNA base methylation
Note(s): Note(s): ...[more].
Reference(s): [1] Bujnicki JM. 2000
[2] Gc K., et al., 2020
External database links:  
DIP:
DIP-10804N
ECOCYC:
G7950-MONOMER
ECOLIWIKI:
b4371
INTERPRO:
IPR002052
INTERPRO:
IPR029063
INTERPRO:
IPR007848
INTERPRO:
IPR013675
INTERPRO:
IPR023543
MODBASE:
P39406
PDB:
2PJD
PFAM:
PF05175
PFAM:
PF08468
PRIDE:
P39406
PRODB:
PRO_000023883
REFSEQ:
NP_418788
SMR:
P39406
UNIPROT:
P39406


Operon      
Name: rsmC         
Operon arrangement:
Transcription unit        Promoter
rsmC


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter rsmCp3 4607725 reverse Similarity to the consensus
Read more >
[ICWHO] [3]
  promoter rsmCp1 4607868 reverse Similarity to the consensus
Read more >
[ICWHO] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Bujnicki JM., 2000, Phylogenomic analysis of 16S rRNA:(guanine-N2) methyltransferases suggests new family members and reveals highly conserved motifs and a domain structure similar to other nucleic acid amino-methyltransferases., FASEB J 14(14):2365-8

 [2] Gc K., Gyawali P., Balci H., Abeysirigunawardena S., 2020, Ribosomal RNA methyltransferase enzyme RsmC moonlights as an RNA chaperone., Chembiochem

 [3] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB