RegulonDB RegulonDB 10.9: Gene Form
   

yjjU gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjjU yjjW yjjV ytjA yjjI terminator anti-terminator anti-anti-terminator TSS_5161 TSS_5161

Gene      
Name: yjjU    Texpresso search in the literature
Synonym(s): ECK4369, G7951, b4377
Genome position(nucleotides): 4612411 --> 4613484 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.91
External database links:  
ASAP:
ABE-0014351
ECHOBASE:
EB2482
ECOLIHUB:
yjjU
OU-MICROARRAY:
b4377
STRING:
511145.b4377
COLOMBOS: yjjU


Product      
Name: putative patatin-like phospholipase YjjU
Synonym(s): YjjU, putative esterase
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 39.832
Isoelectric point: 8.653
Motif(s):
 
Type Positions Sequence
27 -> 196 LVCEGGGQRGIFTAGVLDEFMRAQFNPFDLYLGTSAGAQNLSAFICNQPGYARKVIMRYTTKREFFDPLRFVRGGNLIDLDWLVEATASQMPLQMDTAARLFDSGKSFYMCACRQDDYAPNYFLPTKQNWLDVIRASSAIPGFYRSGVSLEGINYLDGGISDAIPVKEAA
31 -> 36 GGGQRG
59 -> 63 GTSAG
183 -> 185 DGG

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0016787 - hydrolase activity
biological_process GO:0006629 - lipid metabolic process
GO:0006974 - cellular response to DNA damage stimulus
GO:0016042 - lipid catabolic process
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-6892N
ECOCYC:
G7951-MONOMER
ECOLIWIKI:
b4377
INTERPRO:
IPR037483
INTERPRO:
IPR002641
INTERPRO:
IPR016035
MODBASE:
P39407
PFAM:
PF01734
PRIDE:
P39407
PROSITE:
PS51635
REFSEQ:
NP_418794
UNIPROT:
P39407


Operon      
Name: yjjUV         
Operon arrangement:
Transcription unit        Promoter
yjjUV


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5161 4612379 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB