RegulonDB RegulonDB 10.9: Gene Form
   

yjjV gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjjU yjjW yjjV ytjA yjjI terminator anti-terminator anti-anti-terminator TSS_5161 TSS_5161

Gene      
Name: yjjV    Texpresso search in the literature
Synonym(s): ECK4370, G7952, b4378
Genome position(nucleotides): 4613481 --> 4614260 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.51
External database links:  
ASAP:
ABE-0014356
ECHOBASE:
EB2483
ECOLIHUB:
yjjV
OU-MICROARRAY:
b4378
STRING:
511145.b4378
COLOMBOS: yjjV


Product      
Name: putative DNase YjjV
Synonym(s): YjjV
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 28.909
Isoelectric point: 6.605
Motif(s):
 
Type Positions Sequence
6 -> 257 IDTHCHFDFPPFSGDEEASLQRAAQAGVGKIIVPATEAENFARVLALAENYQPLYAALGLHPGMLEKHSDVSLEQLQQALERRPAKVVAVGEIGLDLFGDDPQFERQQWLLDEQLKLAKRYDLPVILHSRRTHDKLAMHLKRHDLPRTGVVHGFSGSLQQAERFVQLGYKIGVGGTITYPRASKTRDVIAKLPLASLLLETDAPDMPLNGFQGQPNRPEQAARVFAVLCELRREPADEIAQALLNNTYTLFN

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0016788 - hydrolase activity, acting on ester bonds
GO:0005515 - protein binding
GO:0016787 - hydrolase activity
GO:0046872 - metal ion binding
GO:0016888 - endodeoxyribonuclease activity, producing 5'-phosphomonoesters
biological_process GO:0006259 - DNA metabolic process
Note(s): Note(s): ...[more].
Evidence: [HIFS] Human inference of function from sequence
Reference(s): [1] Wexler M., et al., 2000
External database links:  
DIP:
DIP-12661N
ECOCYC:
G7952-MONOMER
ECOLIWIKI:
b4378
INTERPRO:
IPR001130
INTERPRO:
IPR032466
INTERPRO:
IPR018228
MODBASE:
P39408
PDB:
1ZZM
PFAM:
PF01026
PRIDE:
P39408
PROSITE:
PS01137
PROSITE:
PS01091
PROSITE:
PS01090
REFSEQ:
YP_026291
SMR:
P39408
UNIPROT:
P39408


Operon      
Name: yjjUV         
Operon arrangement:
Transcription unit        Promoter
yjjUV


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5161 4612379 forward nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Wexler M., Sargent F., Jack RL., Stanley NR., Bogsch EG., Robinson C., Berks BC., Palmer T., 2000, TatD is a cytoplasmic protein with DNase activity. No requirement for TatD family proteins in sec-independent protein export., J Biol Chem 275(22):16717-22

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB