RegulonDB RegulonDB 10.9: Gene Form
   

yjjW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjjI yjjW yjjV deoC yjjU DeoR ModE CRP CytR CytR CytR CRP Fis DeoR DeoR DeoR DeoR DeoR terminator TSS_5164 TSS_5164 TSS_5163 TSS_5163 deoCp2 deoCp2 TSS_5162 TSS_5162 deoCp1 deoCp1

Gene      
Name: yjjW    Texpresso search in the literature
Synonym(s): ECK4371, G7953, b4379
Genome position(nucleotides): 4614680 <-- 4615543 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
56.37
External database links:  
ASAP:
ABE-0014359
ECHOBASE:
EB2484
ECOLIHUB:
yjjW
OU-MICROARRAY:
b4379
STRING:
511145.b4379
COLOMBOS: yjjW


Product      
Name: putative glycyl-radical enzyme activating enzyme YjjW
Synonym(s): YjjW, putative pyruvate formate lyase activating enzyme
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 31.491
Isoelectric point: 6.751
Motif(s):
 
Type Positions Sequence
27 -> 232 FLQGCNLRCKNCHNPWTMGRCNDCGECVPQCPHQALQIVDGKVVWNAVVCEQCDTCLKRCPQHATPMAQSMSVDEVLSHVRKAVLFIEGITVSGGEATTQLPFVVALFTAIKNDPQLRHLTCLVDSNGMLSETGWEKLLPVCDGAMLDLKAWGSECHQQLTGRDNQQIKRSIYLLAERGKLAELRLLVIPGQVDYLQHIEELAAFI
38 -> 67 CHNPWTMGRCNDCGECVPQCPHQALQIVDG
37 -> 39 NCH
67 -> 96 GKVVWNAVVCEQCDTCLKRCPQHATPMAQS
17 -> 284 VDGPGSRLALFLQGCNLRCKNCHNPWTMGRCNDCGECVPQCPHQALQIVDGKVVWNAVVCEQCDTCLKRCPQHATPMAQSMSVDEVLSHVRKAVLFIEGITVSGGEATTQLPFVVALFTAIKNDPQLRHLTCLVDSNGMLSETGWEKLLPVCDGAMLDLKAWGSECHQQLTGRDNQQIKRSIYLLAERGKLAELRLLVIPGQVDYLQHIEELAAFIKGLGDVPVRLNAFHAHGVYGEAQSWASATPEDVEPLADALKVRGVSRLIFPA

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
  3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0046872 - metal ion binding
GO:0016491 - oxidoreductase activity
GO:0051536 - iron-sulfur cluster binding
GO:0051539 - 4 iron, 4 sulfur cluster binding
biological_process GO:0055114 - oxidation-reduction process
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
G7953-MONOMER
ECOLIWIKI:
b4379
INTERPRO:
IPR023912
INTERPRO:
IPR007197
INTERPRO:
IPR013785
INTERPRO:
IPR017896
INTERPRO:
IPR001989
INTERPRO:
IPR034457
INTERPRO:
IPR012839
INTERPRO:
IPR017900
MODBASE:
P39409
PANTHER:
PTHR30352
PFAM:
PF13353
PFAM:
PF04055
PRIDE:
P39409
PROSITE:
PS51918
PROSITE:
PS51379
PROSITE:
PS01087
PROSITE:
PS00198
REFSEQ:
NP_418796
UNIPROT:
P39409


Operon      
Name: yjjW         
Operon arrangement:
Transcription unit        Promoter
yjjW


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_5162 4617277 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5163 4617293 forward nd [RS-EPT-CBR] [1]
  promoter TSS_5164 4617361 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB