RegulonDB RegulonDB 11.2: Gene Form
   

ydaF gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

sieB unknown ydaF ydaG kilS

Gene      
Name: ydaF    Texpresso search in the literature
Synonym(s): ECK1352, G0-10448, b4527
Genome position(nucleotides): 1419156 <-- 1419311
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.36
External database links:  
ASAP:
ABE-0285048
ECHOBASE:
EB2077
ECOLIHUB:
ydaF
STRING:
511145.b4527
COLOMBOS: ydaF


Product      
Name: Rac prophage; DUF1391 domain-containing protein YdaF
Synonym(s): YdaF
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 5.769
Isoelectric point: 9.311
Motif(s):
 
Type Positions Sequence Comment
2 -> 49 QKIDLGNNESLVCGVFPNQDGTFTAMTYTKSKTFKTETGARRWLEKHT
37 -> 42 TETGAR UniProt: In Ref. 1..

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P0ACW0
ECOCYC:
MONOMER0-2670
ECOLIWIKI:
b4527
INTERPRO:
IPR009821
PFAM:
PF07151
PRIDE:
P0ACW0
REFSEQ:
NP_415872
UNIPROT:
P0ACW0


Operon      
Name: ydaGF         
Operon arrangement:
Transcription unit        Promoter
ydaGF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB