RegulonDB RegulonDB 10.9: Gene Form
   

yobH gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

kdgR yobH mgrB PhoP yobHp4 yobHp4 mgrBp mgrBp

Gene      
Name: yobH    Texpresso search in the literature
Synonym(s): ECK1825, G0-10454, b4536
Genome position(nucleotides): 1908925 --> 1909164 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
43.75
External database links:  
ASAP:
ABE-0285057
ECHOBASE:
EB4400
ECOLIHUB:
yobH
STRING:
511145.b4536
COLOMBOS: yobH


Product      
Name: uncharacterized protein YobH
Synonym(s): YobH
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 8.514
Isoelectric point: 9.75
Motif(s):
 
Type Positions Sequence
34 -> 79 AGLGLQCTYLTARGTSTVQYLHTKSGFLGITDCPLLRKSNIVVDNG
2 -> 71 RFIIRTVMLIALVWIGLLLSGYGVLIGSKENAAGLGLQCTYLTARGTSTVQYLHTKSGFLGITDCPLLRK
1 -> 33 MRFIIRTVMLIALVWIGLLLSGYGVLIGSKENA

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-2676
ECOLIWIKI:
b4536
INTERPRO:
IPR025611
PFAM:
PF13996
PRIDE:
Q2MB16
REFSEQ:
YP_588456
UNIPROT:
Q2MB16


Operon      
Name: yobH         
Operon arrangement:
Transcription unit        Promoter
yobH


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yobHp4 1908900 forward Similarity to the consensus
Read more >
[ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB