RegulonDB RegulonDB 10.9: Gene Form
   

arnE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

arnT arnD arnF arnE pmrD arnA

Gene      
Name: arnE    Texpresso search in the literature
Synonym(s): ECK2251, G0-10460, b4544, yfbW
Genome position(nucleotides): 2372557 --> 2372892 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.57
External database links:  
ASAP:
ABE-0285065
ECHOBASE:
EB4090
ECOLIHUB:
arnE
STRING:
511145.b4544
COLOMBOS: arnE


Product      
Name: undecaprenyl-phosphate-α-L-Ara4N flippase - ArnE subunit
Synonym(s): ArnE, YfbW
Sequence: Get amino acid sequence Fasta Format
Cellular location: inner membrane
Molecular weight: 12.192
Isoelectric point: 10.072
Motif(s):
 
Type Positions Sequence
3 -> 107 WLTLVFASLLSVAGQLCQKQATCFVAINKRRKHIVLWLGLALACLGLAMVLWLLVLQNVPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVIL
88 -> 108 PVSPRHWCGVAFIIGGIVILG
36 -> 56 IVLWLGLALACLGLAMVLWLL
40 -> 109 LGLALACLGLAMVLWLLVLQNVPVGIAYPMLSLNFVWVTLAAVKLWHEPVSPRHWCGVAFIIGGIVILGS
62 -> 82 PVGIAYPMLSLNFVWVTLAAV

 

Classification:
Multifun Terms (GenProtEC)  
  4 - transport --> 4.9.A - Transporters of Unknown Classification
  6 - cell structure --> 6.1 - membrane
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
GO:0005886 - plasma membrane
GO:0005887 - integral component of plasma membrane
GO:0016021 - integral component of membrane
molecular_function GO:0022857 - transmembrane transporter activity
GO:1901505 - carbohydrate derivative transmembrane transporter activity
biological_process GO:0006629 - lipid metabolic process
GO:0009103 - lipopolysaccharide biosynthetic process
GO:0009245 - lipid A biosynthetic process
GO:0055085 - transmembrane transport
GO:0010041 - response to iron(III) ion
GO:1901264 - carbohydrate derivative transport
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-2682
ECOLIWIKI:
b4544
INTERPRO:
IPR000620
INTERPRO:
IPR000390
INTERPRO:
IPR022883
PANTHER:
PTHR30561
PFAM:
PF00892
PRIDE:
Q47377
REFSEQ:
YP_588462
UNIPROT:
Q47377


Operon      
Name: arnBCADTEF         
Operon arrangement:
Transcription unit        Promoter
arnBCADTEF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB