RegulonDB RegulonDB 10.9: Gene Form
   

ypjJ gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yfjY yfjZ ypjJ

Gene      
Name: ypjJ    Texpresso search in the literature
Synonym(s): ECK2641, G0-10464, b4548
Genome position(nucleotides): 2776877 --> 2777077 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.73
External database links:  
ASAP:
ABE-0285069
ECHOBASE:
EB4076
ECOLIHUB:
ypjJ
STRING:
511145.b4548
COLOMBOS: ypjJ


Product      
Name: CP4-57 prophage; DUF987 domain-containing protein YpjJ
Synonym(s): YpjJ
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 7.861
Isoelectric point: 10.409
Motif(s):
 
Type Positions Sequence
1 -> 65 MRIISKRRAMTIYRQHPESRIFRYCTGKYQWHGSVCHYTGRDVPDITGVLAVYAERRRTAADRML

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-2686
ECOLIWIKI:
b4548
INTERPRO:
IPR009329
PFAM:
PF06174
PRIDE:
P58033
REFSEQ:
YP_588466
UNIPROT:
P58033


Operon      
Name: yfjXY-ypjJ-yfjZ-ypjF         
Operon arrangement:
Transcription unit        Promoter
yfjXY-ypjJ-yfjZ-ypjF


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB