RegulonDB RegulonDB 10.9: Gene Form
   

yeiW gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

setB fruB yeiP yeiW CRP Cra Cra terminator anti-terminator anti-anti-terminator terminator TSS_2470 TSS_2470 TSS_2469 TSS_2469 yeiWp6 yeiWp6 TSS_2468 TSS_2468 yeiPp yeiPp TSS_2467 (cluster) TSS_2467 (cluster) yeiWp7 yeiWp7 yeiWp yeiWp TSS_2466 TSS_2466 setBp3 setBp3 setBp2 setBp2 fruBp fruBp TSS_2465 TSS_2465 TSS_2464 TSS_2464

Gene      
Name: yeiW    Texpresso search in the literature
Synonym(s): ECK2164, G0-10511, b4502
Genome position(nucleotides): 2265041 <-- 2265295 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.69
External database links:  
ASAP:
ABE-0285016
ECOLIHUB:
yeiW
STRING:
511145.b4502
COLOMBOS: yeiW


Product      
Name: putative metal-chelating domain-containing protein YeiW
Synonym(s): YeiW
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 8.954
Isoelectric point: 6.224
Motif(s):
 
Type Positions Sequence
2 -> 60 ECRPGCGACCTAPSISSPIPGMPDGKPANTPCIQLDEQQRCKIFTSPLRPKVCAGLQAS

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0005515 - protein binding
Note(s): Note(s): ...[more].
External database links:  
ECOCYC:
MONOMER0-2726
ECOLIWIKI:
b4502
INTERPRO:
IPR005358
PFAM:
PF03692
PRIDE:
P0AFT8
REFSEQ:
YP_588461
UNIPROT:
P0AFT8


Operon      
Name: yeiW         
Operon arrangement:
Transcription unit        Promoter
yeiW


Transcriptional Regulation      
Display Regulation             
Activated by: CRP


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_2464 2262611 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_2465 2263594 reverse nd [RS-EPT-CBR] [1]
  promoter setBp2 2263713 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter setBp3 2263836 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2466 2263839 forward nd [RS-EPT-CBR] [1]
  promoter yeiWp7 2265413 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2467 (cluster) 2265414 forward For this promoter, there
Read more >
[RS-EPT-CBR] [1]
  promoter TSS_2468 2265420 forward nd [RS-EPT-CBR] [1]
  promoter yeiWp6 2265420 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_2469 2265428 forward nd [RS-EPT-CBR] [1]
  promoter TSS_2470 2265434 forward nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB