RegulonDB RegulonDB 11.0: Gene Form
   

yjbT gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjbH psiE yjbT CRP PhoB PhoB psiEp psiEp

Gene      
Name: yjbT    Texpresso search in the literature
Synonym(s): ECK4428, G0-10606, b4620
Genome position(nucleotides): 4239777 <-- 4240055
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
49.1
External database links:  
ECOLIHUB:
yjbT
STRING:
511145.b4620
COLOMBOS: yjbT


Product      
Name: PF17089 family protein YjbT
Synonym(s): YjbT
Sequence: Get amino acid sequence Fasta Format
Cellular location: periplasmic space
Molecular weight: 10.049
Isoelectric point: 9.94
Motif(s):
 
Type Positions Sequence Comment
1 -> 92 MKRNLIKVVKMKPYFAALMLSVSVLPAYAGPLGTADKADLPQSNVSSPMMAQSLRQPDLQPISTDRKTECFRLYTPDRKPGVNCVPDGSTGH
30 -> 92 GPLGTADKADLPQSNVSSPMMAQSLRQPDLQPISTDRKTECFRLYTPDRKPGVNCVPDGSTGH UniProt: Uncharacterized protein YjbT.
36 -> 62 DKADLPQSNVSSPMMAQSLRQPDLQPI UniProt: Disordered; Sequence Annotation Type: region of interest.
39 -> 62 DLPQSNVSSPMMAQSLRQPDLQPI UniProt: Polar residues; Sequence Annotation Type: compositionally biased region.

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0030288 - outer membrane-bounded periplasmic space
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
A5A628
ECOCYC:
MONOMER0-2828
ECOLIWIKI:
b4620
INTERPRO:
IPR031382
PFAM:
PF17089
PRIDE:
A5A628
REFSEQ:
YP_001165332
SMR:
A5A628
UNIPROT:
A5A628


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References



RegulonDB