RegulonDB RegulonDB 10.9: Gene Form
   

insJK gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

insJK insK insJ mokA hokA ysaE TSS_4162 TSS_4162 insKp insKp hokAp6 hokAp6 insJp4 insJp4

Gene      
Name: insJK    Texpresso search in the literature
Synonym(s): G0-10624
Genome position(nucleotides): 3720680 --> 3722049 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
44.09
External database links:  
ECOLIHUB:
insJK
COLOMBOS: insJK


Product      
Name: IS150 protein InsAB
Synonym(s): InsJK
Sequence: Get amino acid sequence Fasta Format
Molecular weight: 53.021
Isoelectric point: 10.204
Motif(s):
 
Type Positions Sequence
397 -> 451 ECFFGTLKSECFYLDEFSNISELKDAVTEYIEYYNSRRISLKLKGLTPIEYRNQT
68 -> 114 RIKVVKAVIEQHMSLNQAAAHFMLAGSGSVARWLKVYEERGEAGLRA
216 -> 269 VKKRISEIYHENRGRYGYRRVTLSLHREGKQINHKAVQRLMGTLSLKAAIKVKR
292 -> 390 TRPNEKWVTDVTEFAVNGRKLYLSPVIDLFNNEVISYSLSERPVMNMVENMLDQAFKKLNPHEHPVLHSDQGWQYRMRRYQNILKEHGIKQSMSRKGNC
10 -> 59 KRLEVVNHYFTTDDGYRIISARFGVPRTQVRTWVALYEKHGEKGLIPKPK

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
molecular_function GO:0004803 - transposase activity
biological_process GO:0006313 - transposition, DNA-mediated
Note(s): Note(s): ...[more].
Evidence: [IMP] Inferred from mutant phenotype
Reference(s): [1] Haas M., et al., 2002
External database links:  
ECOCYC:
MONOMER0-2851
PFAM:
PF13518
PFAM:
PF13333
PFAM:
PF00665
PFAM:
PF13276


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter insJp4 3720594 forward Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter hokAp6 3720810 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_4162 3721864 forward nd [RS-EPT-CBR] [3]
  promoter TSS_4163 3722550 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4164 (cluster) 3723367 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]
  promoter TSS_4165 3723961 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_4166 (cluster) 3724383 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Haas M., Rak B., 2002, Escherichia coli insertion sequence IS150: transposition via circular and linear intermediates., J Bacteriol 184(21):5833-41

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB