RegulonDB

RegulonDB RegulonDB 10.9: Gene Form

insH21 gene in Escherichia coli K-12 genome

Gene local context to scale (view description)

Gene
Name:	insH21
Synonym(s):	ECK4568, G0-16639, b4711
Genome position(nucleotides):	1299567 --> 1300547 Genome Browser
Strand:	forward
Sequence:	Get nucleotide sequence FastaFormat
GC content %:	55.05
External database links:

ASAP:	ABE-0285316
COLOMBOS:	insH21

Product

Name:

IS5 transposase and trans-activator

Synonym(s):

InsH21

Sequence:

Get amino acid sequence Fasta Format

Molecular weight:

37.851

Isoelectric point:

10.028

Motif(s):

Type	Positions	Sequence
	51 -> 124	GRRPYPLETMLRIHCMQHWYNLSDGAMEDALYEIASMRLFARLSLDSALPDRTTIMNFRHLLEQHQLARQLFKT
	138 -> 312	QGTLVDATIIEAPSSTKNKEQQRDPEMHQTKKGNQWHFGMKAHIGVDAKSGLTHSLVTTAANEHDLNQLGNLLHGEEQFVSADAGYQGAPQREELAEVDVDWLIAERPGKVRTLKQHPRKNKTAINIEYMKASIRARVEHPFRIIKRQFGFVKARYKGLLKNDNQLAMLFTLANL

Classification:

Multifun Terms (GenProtEC)
Multifun Terms (GenProtEC)		8 - extrachromosomal --> 8.3 - transposon related
Gene Ontology Terms (GO)
	molecular_function	GO:0003677 - DNA binding GO:0004803 - transposase activity
	biological_process	GO:0006310 - DNA recombination GO:0006313 - transposition, DNA-mediated GO:0032196 - transposition

Note(s):

Note(s): ...[more].

External database links:

ECOCYC:

INTERPRO:

INTERPRO:

PFAM:

PFAM:

UNIPROT:

Elements in the selected gene context region unrelated to any object in RegulonDB

Type	Name	Post Left	Strand	Notes	Evidence (Confirmed, Strong, Weak)	References
promoter	TSS_1622 (cluster)	1299471	forward	For this promoter, there is a cluster of 2 transcription start sites,in the interval 1299471 to 1299472, where the highest frequency is at position 1298695. The most upstream position of this cluster is assigned as TSS position in the promoter. Read more >	[RS-EPT-CBR]	[1]
promoter	TSS_1623	1300978	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1624 (cluster)	1301011	forward	For this promoter, there is a cluster of 2 transcription start sites,in the interval 1301011 to 1301012, where the highest frequency is at position 1299035. The most upstream position of this cluster is assigned as TSS position in the promoter. Read more >	[RS-EPT-CBR]	[1]
promoter	TSS_1625	1301043	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1626 (cluster)	1301047	forward	For this promoter, there is a cluster of 2 transcription start sites,in the interval 1301047 to 1301048, where the highest frequency is at position 1299071. The most upstream position of this cluster is assigned as TSS position in the promoter. Read more >	[RS-EPT-CBR]	[1]
promoter	TSS_1627	1301061	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1628 (cluster)	1301063	forward	For this promoter, there is a cluster of 3 transcription start sites,in the interval 1301063 to 1301065, where the highest frequency is at position 1299089. The most upstream position of this cluster is assigned as TSS position in the promoter. Read more >	[RS-EPT-CBR]	[1]
promoter	TSS_1629	1301072	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1630 (cluster)	1301075	forward	For this promoter, there is a cluster of 2 transcription start sites,in the interval 1301075 to 1301076, where the highest frequency is at position 1299100. The most upstream position of this cluster is assigned as TSS position in the promoter. Read more >	[RS-EPT-CBR]	[1]
promoter	TSS_1631 (cluster)	1301130	forward	For this promoter, there is a cluster of 2 transcription start sites,in the interval 1301130 to 1301131, where the highest frequency is at position 1299154. The most upstream position of this cluster is assigned as TSS position in the promoter. Read more >	[RS-EPT-CBR]	[1]
promoter	TSS_1632	1301156	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1633	1301325	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1634	1301421	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1635 (cluster)	1301440	forward	For this promoter, there is a cluster of 2 transcription start sites,in the interval 1301440 to 1301441, where the highest frequency is at position 1299465. The most upstream position of this cluster is assigned as TSS position in the promoter. Read more >	[RS-EPT-CBR]	[1]
promoter	TSS_1636 (cluster)	1301445	forward	For this promoter, there is a cluster of 2 transcription start sites,in the interval 1301445 to 1301446, where the highest frequency is at position 1299469. The most upstream position of this cluster is assigned as TSS position in the promoter. Read more >	[RS-EPT-CBR]	[1]
promoter	TSS_1637 (cluster)	1301448	forward	For this promoter, there is a cluster of 2 transcription start sites,in the interval 1301448 to 1301449, where the highest frequency is at position 1299472. The most upstream position of this cluster is assigned as TSS position in the promoter. Read more >	[RS-EPT-CBR]	[1]
promoter	TSS_1638 (cluster)	1301452	forward	For this promoter, there is a cluster of 9 transcription start sites,in the interval 1301452 to 1301460, where the highest frequency is at position 1299484. The most upstream position of this cluster is assigned as TSS position in the promoter. Read more >	[RS-EPT-CBR]	[1]
promoter	TSS_1639 (cluster)	1301462	forward	For this promoter, there is a cluster of 8 transcription start sites,in the interval 1301462 to 1301469, where the highest frequency is at position 1299487. The most upstream position of this cluster is assigned as TSS position in the promoter. Read more >	[RS-EPT-CBR]	[1]
promoter	TSS_1640 (cluster)	1301471	forward	For this promoter, there is a cluster of 3 transcription start sites,in the interval 1301471 to 1301473, where the highest frequency is at position 1299496. The most upstream position of this cluster is assigned as TSS position in the promoter. Read more >	[RS-EPT-CBR]	[1]
promoter	TSS_1641	1301475	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1642	1301479	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1643	1301484	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1644	1301505	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1645 (cluster)	1301513	forward	For this promoter, there is a cluster of 2 transcription start sites,in the interval 1301513 to 1301514, where the highest frequency is at position 1299537. The most upstream position of this cluster is assigned as TSS position in the promoter. Read more >	[RS-EPT-CBR]	[1]
promoter	TSS_1646	1301585	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1647 (cluster)	1301592	forward	For this promoter, there is a cluster of 3 transcription start sites,in the interval 1301592 to 1301594, where the highest frequency is at position 1299616. The most upstream position of this cluster is assigned as TSS position in the promoter. Read more >	[RS-EPT-CBR]	[1]
promoter	TSS_1648	1301596	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1649	1301629	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1650	1301632	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1651	1301651	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1652 (cluster)	1301927	forward	For this promoter, there is a cluster of 2 transcription start sites,in the interval 1301927 to 1301928, where the highest frequency is at position 1299952. The most upstream position of this cluster is assigned as TSS position in the promoter. Read more >	[RS-EPT-CBR]	[1]
promoter	TSS_1653	1301955	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1654	1301979	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1655	1302037	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1656	1302088	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1657	1302221	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1658	1302237	forward	nd	[RS-EPT-CBR]	[1]
promoter	TSS_1659	1302457	forward	nd	[RS-EPT-CBR]	[1]

Evidence
[RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

Reference(s)
[1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

Reference(s)

[1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

RegulonDB