RegulonDB RegulonDB 11.0: Gene Form
   

ytiA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

yjiM yjiK yjiL ytiA yjiLp3 yjiLp3 yjiLp2 yjiLp2 yjiKp9 yjiKp9 yjiKp7 yjiKp7 yjiKp6 yjiKp6

Gene      
Name: ytiA    Texpresso search in the literature
Synonym(s): ECK4572, G0-16640, b4715
Genome position(nucleotides): 4563668 <-- 4563925
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.71
External database links:  
ASAP:
ABE-0285711
COLOMBOS: ytiA


Product      
Name: uncharacterized protein YtiA
Synonym(s): YtiA
Sequence: Get amino acid sequence Fasta Format
Cellular location: membrane
Molecular weight: 9.556
Isoelectric point: 7.849
Motif(s):
 
Type Positions Sequence Comment
4 -> 57 FLFLFHSTVGVIQTRKALQAAGMTFRVSDIPRDLRGGCGLCIWLTCPPGEEIQW

 

Classification:
Multifun Terms (GenProtEC)  
Gene Ontology Terms (GO)  
cellular_component GO:0016020 - membrane
Note(s): Note(s): ...[more].
External database links:  
ALPHAFOLD:
P0DN74
ECOCYC:
MONOMER0-4349
INTERPRO:
IPR021778
PFAM:
PF11823
REFSEQ:
WP_000657675
UNIPROT:
P0DN74


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter yjiKp6 4563635 reverse nd [ICWHO] [1]
  promoter yjiKp7 4563730 reverse nd [ICWHO] [1]
  promoter yjiKp9 4563734 reverse nd [ICWHO] [1]
  promoter yjiLp2 4564793 reverse nd [ICWHO] [1]
  promoter yjiLp3 4564802 reverse nd [ICWHO] [1]


Evidence    

 [ICWHO] Inferred computationally without human oversight



Reference(s)    

 [1] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78


RegulonDB