RegulonDB

Gene
Name:	cheW
Synonym(s):	ECK1888, EG10149, b1887
Genome position(nucleotides):	1972836 <-- 1973339
Strand:	reverse
Sequence:	Get nucleotide sequence FastaFormat
GC content %:	51.98
External database links:

ASAP:	ABE-0006292
CGSC:	925
ECHOBASE:	EB0147
ECOLIHUB:	cheW
OU-MICROARRAY:	b1887
STRING:	511145.b1887
COLOMBOS:	cheW

Gene

Name:

cheW

Synonym(s):

ECK1888, EG10149, b1887

Genome position(nucleotides):

1972836 <-- 1973339

Strand:

reverse

Sequence:

Get nucleotide sequence FastaFormat

GC content %:

51.98

External database links:

ASAP:

CGSC:

ECHOBASE:

ECOLIHUB:

OU-MICROARRAY:

STRING:

COLOMBOS:

Type

Positions

Sequence

Comment

16 -> 16

UniProt: In Ref. 5; AAA23575..

18 -> 154

EFLVFTLGDEEYGIDILKVQEIRGYDQVTRIANTPAFIKGVTNLRGVIVPIVDLRIKFSQVDVDYNDNTVVIVLNLGQRVVGIVVDGVSDVLSLTAEQIRPAPEFAVTLSTEYLTGLGALGDRMLILVNIEKLLNSE

36 -> 36

V → M: loss of function mutation; unable to bind Tar, diminished affinity for CheA and unable to form an activated ternary complex in vitro

38 -> 38

E → D: large decrease in affinity for Tar combined with a small decrease in affinity for CheA; less effective than wild-type CheW in mediating Tar-CheA coupling (as measured by CheA autokinase activity) in vitro

41 -> 41

G → D: diminished support for chemotaxis; unlike the wild type protein does not inhibit swarming when over-expressed; moderate decreases in affinity for Tar and CheA and defective in the ability to form an activated ternary complex in vitro

Type

Positions

Sequence

Comment

16 -> 16

UniProt: In Ref. 5; AAA23575..

18 -> 154

EFLVFTLGDEEYGIDILKVQEIRGYDQVTRIANTPAFIKGVTNLRGVIVPIVDLRIKFSQVDVDYNDNTVVIVLNLGQRVVGIVVDGVSDVLSLTAEQIRPAPEFAVTLSTEYLTGLGALGDRMLILVNIEKLLNSE

36 -> 36

V → M: loss of function mutation; unable to bind Tar, diminished affinity for CheA and unable to form an activated ternary complex in vitro

38 -> 38

41 -> 41

45 -> 45

V → L: dimished affinity for CheA but not for Tar; less effective than wild-type CheW in mediating Tar-CheA coupling (as measured by CheA autokinase activity) in vitro

46 -> 46

T → S/A: dimished affinity for CheA but not for Tar; less effective than wild-type CheW in mediating Tar-CheA coupling (as measured by CheA autokinase activity) in vitro

51 -> 51

T → A/P: dimished affinity for CheA but not for Tar

56 -> 56

K → I: dimished affinity for CheA but not for Tar; less effective than wild-type CheW in mediating Tar-CheA coupling (as measured by CheA autokinase activity) in vitro

57 -> 57

G → D: loss of function mutation; lacks detectable binding to CheA; diminished affinity for Tar and unable to form an activated ternary complex in vitro

62 -> 62

R → H: loss of function mutation; small decreases in affinity for Tar and CheA and decreased ability to form an activated ternary complex in vitro

65 -> 65

I → N: dimished affinity for CheA but not for Tar

133 -> 133

G → E: dimished support for chemotaxis; unlike the wild-type protein does not inhibit swarming when overexpressed; moderate decreases in affinity for Tar and CheA and defective in the ability to form an activated ternary complex in vitro

156 -> 156

M → V: dimished affinity for CheA but not for Tar

158 -> 158

L → Q: dimished affinity for CheA but not for Tar

Multifun Terms (GenProtEC)

3 - regulation --> 3.1 - type of regulation --> 3.1.3 - posttranscriptional --> 3.1.3.3 - inhibition / activation of enzymes

5 - cell processes --> 5.3 - motility, chemotaxis, energytaxis (aerotaxis, redoxtaxis etc)

Gene Ontology Terms (GO)

cellular_component

GO:0098561 - methyl accepting chemotaxis protein complex
GO:0051286 - cell tip
GO:0005737 - cytoplasm
GO:0005829 - cytosol
GO:0005886 - plasma membrane

molecular_function

GO:0019904 - protein domain specific binding
GO:0005515 - protein binding
GO:0042803 - protein homodimerization activity

biological_process

GO:1901875 - positive regulation of post-translational protein modification
GO:0010864 - positive regulation of protein histidine kinase activity
GO:0007165 - signal transduction
GO:0006935 - chemotaxis
GO:0051649 - establishment of localization in cell
GO:0009454 - aerotaxis

Transcriptional Regulation
	Display Regulation
Repressed by:	CpxR

Transcriptional Regulation

Display Regulation

Repressed by:

CpxR

	Type	Name	Post Left	Post Right	Strand	Notes	Evidence (Confirmed, Strong, Weak)	References
	promoter	cheWp5	1973462		reverse	nd	[COMP-AINF]	[12]
	promoter	TSS_2228	1973726		reverse	nd	[RS-EPT-CBR]	[13]

Type

Name

Post Left

Post Right

Strand

Notes

Evidence (Confirmed, Strong, Weak)

References

promoter

cheWp5

1973462

reverse

[COMP-AINF]

[12]

promoter

TSS_2228

1973726

reverse

[RS-EPT-CBR]

[13]

Evidence
[COMP-AINF] Inferred computationally without human oversight
[RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

Evidence

[COMP-AINF] Inferred computationally without human oversight

[RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates

Reference(s)
[1] Cashman DJ., Ortega DR., Zhulin IB., Baudry J., 2013, Homology modeling of the CheW coupling protein of the chemotaxis signaling complex., PLoS One 8(8):e70705
[2] Cassidy CK., Himes BA., Sun D., Ma J., Zhao G., Parkinson JS., Stansfeld PJ., Luthey-Schulten Z., Zhang P., 2020, Structure and dynamics of the E. coli chemotaxis core signaling complex by cryo-electron tomography and molecular simulations., Commun Biol 3(1):24
[3] Gegner JA., Graham DR., Roth AF., Dahlquist FW., 1992, Assembly of an MCP receptor, CheW, and kinase CheA complex in the bacterial chemotaxis signal transduction pathway., Cell 70(6):975-82
[4] Liu JD., Parkinson JS., 1991, Genetic evidence for interaction between the CheW and Tsr proteins during chemoreceptor signaling by Escherichia coli., J Bacteriol 173(16):4941-51
[5] Liu JD., Parkinson JS., 1989, Role of CheW protein in coupling membrane receptors to the intracellular signaling system of bacterial chemotaxis., Proc Natl Acad Sci U S A 86(22):8703-7
[6] Maddock JR., Shapiro L., 1993, Polar location of the chemoreceptor complex in the Escherichia coli cell., Science 259(5102):1717-23
[7] Mutoh N., Simon MI., 1986, Nucleotide sequence corresponding to five chemotaxis genes in Escherichia coli., J Bacteriol 165(1):161-6
[8] Parkinson JS., 1978, Complementation analysis and deletion mapping of Escherichia coli mutants defective in chemotaxis., J Bacteriol 135(1):45-53
[9] Sourjik V., Berg HC., 2000, Localization of components of the chemotaxis machinery of Escherichia coli using fluorescent protein fusions., Mol Microbiol 37(4):740-51
[10] Underbakke ES., Zhu Y., Kiessling LL., 2011, Protein footprinting in a complex milieu: identifying the interaction surfaces of the chemotaxis adaptor protein CheW., J Mol Biol 409(4):483-95
[11] Wolfe AJ., Conley MP., Kramer TJ., Berg HC., 1987, Reconstitution of signaling in bacterial chemotaxis., J Bacteriol 169(5):1878-85
[12] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78
[13] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.

Reference(s)

[1] Cashman DJ., Ortega DR., Zhulin IB., Baudry J., 2013, Homology modeling of the CheW coupling protein of the chemotaxis signaling complex., PLoS One 8(8):e70705

[2] Cassidy CK., Himes BA., Sun D., Ma J., Zhao G., Parkinson JS., Stansfeld PJ., Luthey-Schulten Z., Zhang P., 2020, Structure and dynamics of the E. coli chemotaxis core signaling complex by cryo-electron tomography and molecular simulations., Commun Biol 3(1):24

[3] Gegner JA., Graham DR., Roth AF., Dahlquist FW., 1992, Assembly of an MCP receptor, CheW, and kinase CheA complex in the bacterial chemotaxis signal transduction pathway., Cell 70(6):975-82

[4] Liu JD., Parkinson JS., 1991, Genetic evidence for interaction between the CheW and Tsr proteins during chemoreceptor signaling by Escherichia coli., J Bacteriol 173(16):4941-51

[5] Liu JD., Parkinson JS., 1989, Role of CheW protein in coupling membrane receptors to the intracellular signaling system of bacterial chemotaxis., Proc Natl Acad Sci U S A 86(22):8703-7

[6] Maddock JR., Shapiro L., 1993, Polar location of the chemoreceptor complex in the Escherichia coli cell., Science 259(5102):1717-23

[7] Mutoh N., Simon MI., 1986, Nucleotide sequence corresponding to five chemotaxis genes in Escherichia coli., J Bacteriol 165(1):161-6

[8] Parkinson JS., 1978, Complementation analysis and deletion mapping of Escherichia coli mutants defective in chemotaxis., J Bacteriol 135(1):45-53

[9] Sourjik V., Berg HC., 2000, Localization of components of the chemotaxis machinery of Escherichia coli using fluorescent protein fusions., Mol Microbiol 37(4):740-51

[10] Underbakke ES., Zhu Y., Kiessling LL., 2011, Protein footprinting in a complex milieu: identifying the interaction surfaces of the chemotaxis adaptor protein CheW., J Mol Biol 409(4):483-95

[11] Wolfe AJ., Conley MP., Kramer TJ., Berg HC., 1987, Reconstitution of signaling in bacterial chemotaxis., J Bacteriol 169(5):1878-85

[12] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

[13] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.