RegulonDB RegulonDB 10.9: Gene Form
   

fbaA gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

pgk fbaA mscS anti-anti-terminator anti-terminator terminator anti-anti-terminator anti-terminator terminator TSS_3248 TSS_3248 TSS_3247 TSS_3247 TSS_3246 TSS_3246 TSS_3245 (cluster) TSS_3245 (cluster) TSS_3244 (cluster) TSS_3244 (cluster) TSS_3243 TSS_3243 TSS_3242 TSS_3242 TSS_3241 TSS_3241 TSS_3240 TSS_3240 TSS_3239 TSS_3239 TSS_3238 TSS_3238 TSS_3237 TSS_3237 TSS_3236 TSS_3236 TSS_3235 TSS_3235 TSS_3234 TSS_3234 TSS_3233 TSS_3233 TSS_3232 (cluster) TSS_3232 (cluster) TSS_3231 TSS_3231 TSS_3230 TSS_3230 TSS_3229 TSS_3229 TSS_3228 TSS_3228 TSS_3227 (cluster) TSS_3227 (cluster) TSS_3226 TSS_3226 TSS_3225 TSS_3225 TSS_3224 TSS_3224 TSS_3223 TSS_3223 TSS_3222 TSS_3222 TSS_3221 TSS_3221 TSS_3220 TSS_3220 TSS_3219 (cluster) TSS_3219 (cluster) TSS_3218 (cluster) TSS_3218 (cluster) TSS_3217 TSS_3217 TSS_3216 TSS_3216 TSS_3215 TSS_3215 TSS_3214 TSS_3214 TSS_3213 TSS_3213 TSS_3212 TSS_3212 TSS_3211 TSS_3211 TSS_3210 TSS_3210 TSS_3209 TSS_3209 mscSp mscSp

Gene      
Name: fbaA    Texpresso search in the literature
Synonym(s): ECK2921, EG10282, ald, b2925, fba, fda
Genome position(nucleotides): 3070165 <-- 3071244 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
51.11
Reference(s): [1] Alefounder PR., et al., 1989
External database links:  
ASAP:
ABE-0009600
CGSC:
786
ECHOBASE:
EB0278
ECOLIHUB:
fbaA
OU-MICROARRAY:
b2925
STRING:
511145.b2925
COLOMBOS: fbaA


Product      
Name: fructose-bisphosphate aldolase class II
Synonym(s): Ald, Fba, FbaA, Fda
Sequence: Get amino acid sequence Fasta Format
Cellular location: cell wall,inner membrane,cytosol
Molecular weight: 39.147
Isoelectric point: 5.715
Motif(s):
 
Type Positions Sequence
287 -> 290 NIDT
2 -> 359 SKIFDFVKPGVITGDDVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNAIDVL
266 -> 268 GGS
62 -> 62 S
17 -> 355 DVQKVFQVAKENNFALPAVNCVGTDSINAVLETAAKVKAPVIVQFSNGGASFIAGKGVKSDVPQGAAILGAISGAHHVHQMAEHYGVPVILHTDHCAKKLLPWIDGLLDAGEKHFAATGKPLFSSHMIDLSEESLQENIEICSKYLERMSKIGMTLEIELGCTGGEEDGVDNSHMDASALYTQPEDVDYAYTELSKISPRFTIAASFGNVHGVYKPGNVVLTPTILRDSQEYVSKKHNLPHNSLNFVFHGGSGSTAQEIKDSVSYGVVKMNIDTDTQWATWEGVLNYYKANEAYLQGQLGNPKGEDQPNKKYYDPRVWLRAGQTSMIARLEKAFQELNA

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005886 - plasma membrane
GO:0005618 - cell wall
molecular_function GO:0003824 - catalytic activity
GO:0005515 - protein binding
GO:0016829 - lyase activity
GO:0046872 - metal ion binding
GO:0016832 - aldehyde-lyase activity
GO:0008270 - zinc ion binding
GO:0004332 - fructose-bisphosphate aldolase activity
GO:0042802 - identical protein binding
GO:0042803 - protein homodimerization activity
biological_process GO:0005975 - carbohydrate metabolic process
GO:0006094 - gluconeogenesis
GO:0006096 - glycolytic process
External database links:  
DIP:
DIP-31872N
ECOCYC:
FRUCTBISALD-CLASSII-MONOMER
ECOLIWIKI:
b2925
INTERPRO:
IPR006411
INTERPRO:
IPR013785
INTERPRO:
IPR000771
PANTHER:
PTHR30559
PDB:
5VJE
PDB:
5VJD
PDB:
5GK7
PDB:
5GK8
PDB:
1B57
PDB:
1DOS
PDB:
1GYN
PDB:
1ZEN
PDB:
5GK3
PDB:
5GK4
PDB:
5GK5
PDB:
5GK6
PFAM:
PF01116
PRIDE:
P0AB71
PRODB:
PRO_000022574
PROSITE:
PS00806
PROSITE:
PS00602
REFSEQ:
NP_417400
SMR:
P0AB71
UNIPROT:
P0AB71


Operon      
Name: epd-pgk-fbaA         
Operon arrangement:
Transcription unit        Promoter
pgk
pgk-fbaA
pgk
pgk-fbaA
pgk
pgk-fbaA
epd-pgk
epd-pgk-fbaA
epd-pgk
epd-pgk-fbaA


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: Cra


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3209 3070765 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3210 3070776 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3211 3070817 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3212 3070829 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3213 3070877 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3214 3070946 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3215 3070948 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3216 3070980 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3217 3071020 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3218 (cluster) 3071228 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3219 (cluster) 3071234 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3220 3071237 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3221 3071240 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3222 3071246 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3223 3071253 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3224 3071257 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3225 3071259 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3226 3071272 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3227 (cluster) 3071402 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3228 3071654 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3229 3071673 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3230 3071681 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3231 3071926 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3232 (cluster) 3071970 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3233 3071974 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3234 3072004 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3235 3072006 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3236 3072009 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3237 3072011 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3238 3072030 forward nd [RS-EPT-CBR] [2]
  promoter TSS_3239 3072032 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3240 3072041 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3241 3072121 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3242 3072341 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3243 3072348 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3244 (cluster) 3072367 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3245 (cluster) 3072371 reverse For this promoter, there
Read more >
[RS-EPT-CBR] [2]
  promoter TSS_3246 3072373 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3247 3072375 reverse nd [RS-EPT-CBR] [2]
  promoter TSS_3248 3072393 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Alefounder PR., Perham RN., 1989, Identification, molecular cloning and sequence analysis of a gene cluster encoding the class II fructose 1,6-bisphosphate aldolase, 3-phosphoglycerate kinase and a putative second glyceraldehyde 3-phosphate dehydrogenase of Escherichia coli., Mol Microbiol 3(6):723-32

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB