RegulonDB RegulonDB 10.9: Gene Form
   

map gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

glnD map tff ppGpp anti-anti-terminator anti-terminator terminator anti-anti-terminator anti-terminator terminator terminator rpsBp rpsBp TSS_315 TSS_315 TSS_314 TSS_314 TSS_313 TSS_313 TSS_312 TSS_312 TSS_311 TSS_311 TSS_310 TSS_310 glnDp glnDp

Gene      
Name: map    Texpresso search in the literature
Synonym(s): ECK0166, EG10570, b0168
Genome position(nucleotides): 188712 <-- 189506 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
50.44
External database links:  
ASAP:
ABE-0000571
CGSC:
30569
ECHOBASE:
EB0565
ECOLIHUB:
map
OU-MICROARRAY:
b0168
STRING:
511145.b0168
COLOMBOS: map


Product      
Name: methionine aminopeptidase
Synonym(s): Map
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 29.331
Isoelectric point: 5.83
Motif(s):
 
Type Positions Sequence
79 -> 79 H
97 -> 97 D
178 -> 178 H
2 -> 264 AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIISHDE
12 -> 242 EKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTD

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.3 - posttranslational modification
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0008233 - peptidase activity
GO:0016787 - hydrolase activity
GO:0043022 - ribosome binding
GO:0046872 - metal ion binding
GO:0004177 - aminopeptidase activity
GO:0008198 - ferrous iron binding
GO:0070006 - metalloaminopeptidase activity
biological_process GO:0006508 - proteolysis
GO:0070084 - protein initiator methionine removal
Note(s): Note(s): ...[more].
Reference(s): [1] Chai SC., et al., 2009
[2] Chai SC., et al., 2010
External database links:  
DIP:
DIP-48040N
ECOCYC:
EG10570-MONOMER
ECOLIWIKI:
B0168
INTERPRO:
IPR036005
INTERPRO:
IPR002467
INTERPRO:
IPR001714
INTERPRO:
IPR000994
MODBASE:
P0AE18
PDB:
2GG7
PDB:
6J0A
PDB:
6IZI
PDB:
6IZ7
PDB:
4Z7M
PDB:
4MAT
PDB:
3MAT
PDB:
3D27
PDB:
2Q96
PDB:
1C21
PDB:
1C22
PDB:
1C23
PDB:
1C24
PDB:
1C27
PDB:
1MAT
PDB:
1XNZ
PDB:
1YVM
PDB:
2BB7
PDB:
2EVC
PDB:
2EVM
PDB:
2EVO
PDB:
2GG0
PDB:
2GG2
PDB:
2GG3
PDB:
2GG5
PDB:
2GG8
PDB:
2GG9
PDB:
2GGB
PDB:
2GGC
PDB:
2GTX
PDB:
2GU4
PDB:
2GU5
PDB:
2GU6
PDB:
2GU7
PDB:
2MAT
PDB:
2P98
PDB:
2P99
PDB:
2P9A
PDB:
2Q92
PDB:
2Q93
PDB:
2Q94
PDB:
2Q95
PFAM:
PF00557
PRIDE:
P0AE18
PRINTS:
PR00599
PRODB:
PRO_000023165
PROSITE:
PS00680
REFSEQ:
NP_414710
SMR:
P0AE18
SWISSMODEL:
P0AE18
UNIPROT:
P0AE18


Operon      
Name: map-glnD-dapD         
Operon arrangement:
Transcription unit        Promoter
dapD
glnD
map-glnD-dapD


RNA cis-regulatory element    
Attenuation: Transcriptional


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_310 189471 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_311 189532 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_312 189545 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_313 189553 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_314 189621 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_315 189639 forward nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Chai SC., Ye QZ., 2009, Metal-mediated inhibition is a viable approach for inhibiting cellular methionine aminopeptidase., Bioorg Med Chem Lett 19(24):6862-4

 [2] Chai SC., Ye QZ., 2010, A cell-based assay that targets methionine aminopeptidase in a physiologically relevant environment., Bioorg Med Chem Lett 20(7):2129-32

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB