RegulonDB RegulonDB 10.8: Gene Form
   

mtlD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

mtlA mtlD mtlR yibT Fis TSS_4181 TSS_4181 TSS_4180 TSS_4180 TSS_4179 TSS_4179

Gene      
Name: mtlD    Texpresso search in the literature
Synonym(s): ECK3589, EG10616, b3600
Genome position(nucleotides): 3774424 --> 3775572 Genome Browser
Strand: forward
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.39
External database links:  
ASAP:
ABE-0011767
CGSC:
479
ECHOBASE:
EB0611
OU-MICROARRAY:
b3600
PortEco:
mtlD
STRING:
511145.b3600
COLOMBOS: mtlD


Product      
Name: mannitol-1-phosphate 5-dehydrogenase
Synonym(s): MtlD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 41.139
Isoelectric point: 5.283
Motif(s):
 
Type Positions Sequence
14 -> 15 GF
148 -> 373 EHVGFVDSAVDRIVPPSASATNDPLEVTVETFSEWIVDKTQFKGALPNIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAILDEKIRAVVKGAMEESGAVLIKRYGFDADKHAAYIQKILGRFENPYLKDDVERVGRQPLRKLSAGDRLIKPLLGTLEYGLPHKNLIEGIAAAMHFRSEDDPQAQELAALIADKGPQAALAQISGLDANSEVVSE
1 -> 123 MKALHFGAGNIGRGFIGKLLADAGIQLTFADVNQVVLDALNARHSYQVHVVGETEQVDTVSGVNAVSSIGDDVVDLIAQVDLVTTAVGPVVLERIAPAIAKGQVKRKEQGNESPLNIIACENM
5 -> 5 H
86 -> 86 A

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.1 - carbon utilization --> 1.1.1 - carbon compounds
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
molecular_function GO:0003824 - catalytic activity
GO:0016491 - oxidoreductase activity
GO:0016616 - oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0050662 - coenzyme binding
GO:0008926 - mannitol-1-phosphate 5-dehydrogenase activity
biological_process GO:0055114 - oxidation-reduction process
GO:0019594 - mannitol metabolic process
GO:0019592 - mannitol catabolic process
Note(s): Note(s): ...[more].
Reference(s): [1] Davis T., et al., 1988
[2] Lee CA., et al., 1983
[3] Lengeler J., et al., 1972
[4] Reshamwala SM., et al., 2014
[5] Rosenberg H., et al., 1984
[6] Rosenberg H., et al., 1984
External database links:  
DIP:
DIP-10268N
ECOCYC:
MANNPDEHYDROG-MONOMER
ECOLIWIKI:
b3600
INTERPRO:
IPR013118
INTERPRO:
IPR036291
INTERPRO:
IPR023028
INTERPRO:
IPR023027
INTERPRO:
IPR013328
INTERPRO:
IPR013131
INTERPRO:
IPR008927
INTERPRO:
IPR000669
MINT:
MINT-1240338
MODBASE:
P09424
PFAM:
PF01232
PFAM:
PF08125
PRIDE:
P09424
PRINTS:
PR00084
PRODB:
PRO_000023304
PROSITE:
PS00974
REFSEQ:
NP_418057
SMR:
P09424
UNIPROT:
P09424


Operon      
Name: mtlADR         
Operon arrangement:
Transcription unit        Promoter
mtlADR


Transcriptional Regulation      
Display Regulation             
Activated by: CRP
Repressed by: Cra, Fis


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_4179 3774405 forward nd [RS-EPT-CBR] [7]
  promoter TSS_4180 3774416 forward nd [RS-EPT-CBR] [7]
  promoter TSS_4181 3774432 forward nd [RS-EPT-CBR] [7]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Davis T., Yamada M., Elgort M., Saier MH., 1988, Nucleotide sequence of the mannitol (mtl) operon in Escherichia coli., Mol Microbiol 2(3):405-12

 [2] Lee CA., Saier MH., 1983, Use of cloned mtl genes of Escherichia coli to introduce mtl deletion mutations into the chromosome., J Bacteriol 153(2):685-92

 [3] Lengeler J., Lin EC., 1972, Reversal of the mannitol-sorbitol diauxie in Escherichia coli., J Bacteriol 112(2):840-8

 [4] Reshamwala SM., Pagar SK., Velhal VS., Maranholakar VM., Talangkar VG., Lali AM., 2014, Construction of an efficient Escherichia coli whole-cell biocatalyst for D-mannitol production., J Biosci Bioeng 118(6):628-31

 [5] Rosenberg H., Hardy CM., 1984, Conversion of D-mannitol to D-ribose: a newly discovered pathway in Escherichia coli., J Bacteriol 158(1):69-72

 [6] Rosenberg H., Pearce SM., Hardy CM., Jacomb PA., 1984, Rapid turnover of mannitol-1-phosphate in Escherichia coli., J Bacteriol 158(1):63-8

 [7] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB