RegulonDB RegulonDB 10.9: Gene Form
   

parE gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

parE yqiA ygiN TSS_3330 TSS_3330 TSS_3329 TSS_3329

Gene      
Name: parE    Texpresso search in the literature
Synonym(s): ECK3021, EG10687, b3030, nfxD
Genome position(nucleotides): 3173504 <-- 3175396 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.57
External database links:  
ASAP:
ABE-0009950
CGSC:
33451
ECHOBASE:
EB0681
ECOLIHUB:
parE
OU-MICROARRAY:
b3030
STRING:
511145.b3030
COLOMBOS: parE


Product      
Name: DNA topoisomerase IV subunit B
Synonym(s): NfxD, ParE
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 70.244
Isoelectric point: 5.359
Motif(s):
 
Type Positions Sequence
445 -> 445 L
556 -> 620 GKPNVQRFKGLGEMNPMQLRETTLDPNTRRLVQLTIDDEDDQRTDAMMDMLLAKKRSEDRRNWLQ
110 -> 116 GLHGVGI
218 -> 384 GLNDYLAEAVNGLPTLPEKPFIGNFAGDTEAVDWALLWLPEGGELLTESYVNLIPTMQGGTHVNGLRQGLLDAMREFCEYRNILPRGVKLSAEDIWDRCAYVLSVKMQDPQFAGQTKERLSSRQCAAFVSGVVKDAFILWLNQNVQAAELLAEMAISSAQRRMRAAK
313 -> 313 W

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.1 - DNA related --> 2.1.1 - DNA replication
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005694 - chromosome
molecular_function GO:0003677 - DNA binding
GO:0003916 - DNA topoisomerase activity
GO:0005515 - protein binding
GO:0016853 - isomerase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0003918 - DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
biological_process GO:0046677 - response to antibiotic
GO:0006265 - DNA topological change
GO:0051276 - chromosome organization
GO:0007059 - chromosome segregation
GO:0007062 - sister chromatid cohesion
GO:0030541 - plasmid partitioning
Note(s): Note(s): ...[more].
External database links:  
DIP:
DIP-10441N
ECOCYC:
EG10687-MONOMER
ECOLIWIKI:
b3030
INTERPRO:
IPR013759
INTERPRO:
IPR036890
INTERPRO:
IPR020568
INTERPRO:
IPR018522
INTERPRO:
IPR014721
INTERPRO:
IPR013760
INTERPRO:
IPR013506
INTERPRO:
IPR006171
INTERPRO:
IPR005737
INTERPRO:
IPR003594
INTERPRO:
IPR002288
INTERPRO:
IPR001241
MODBASE:
P20083
PANTHER:
PTHR10169
PDB:
1S14
PDB:
4HZ0
PDB:
1S16
PDB:
3FV5
PFAM:
PF00986
PFAM:
PF00204
PFAM:
PF01751
PFAM:
PF02518
PRIDE:
P20083
PRODB:
PRO_000023494
PROSITE:
PS00177
PROSITE:
PS50880
REFSEQ:
NP_417502
SMART:
SM00433
SMART:
SM00387
SMR:
P20083
UNIPROT:
P20083


Operon      
Name: nudF-yqiB-cpdA-yqiA-parE         
Operon arrangement:
Transcription unit        Promoter
nudF-yqiB-cpdA-yqiA-parE


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3329 3174907 reverse nd [RS-EPT-CBR] [1]
  promoter TSS_3330 3175645 reverse nd [RS-EPT-CBR] [1]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB