RegulonDB RegulonDB 10.9: Gene Form
   

recB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

recB recC ptrA recD argA LexA ptrAp ptrAp TSS_3127 TSS_3127

Gene      
Name: recB    Texpresso search in the literature
Synonym(s): ECK2816, EG10824, b2820, ior, rorA
Genome position(nucleotides): 2952461 <-- 2956003 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
54.56
External database links:  
ASAP:
ABE-0009249
CGSC:
311
ECHOBASE:
EB0817
ECOLIHUB:
recB
OU-MICROARRAY:
b2820
STRING:
511145.b2820
COLOMBOS: recB


Product      
Name: exodeoxyribonuclease V subunit RecB
Synonym(s): Ior, RecB, RorA
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 133.959
Isoelectric point: 4.927
Motif(s):
 
Type Positions Sequence
252 -> 254 IDR
560 -> 561 SR
950 -> 1147 SPGTFLHSLFEDLDFTQPVDPNWVREKLELGGFESQWEPVLTEWITAVLQAPLNETGVSLSQLSARNKQVEMEFYLPISEPLIASQLDTLIRQFDPLSAGCPPLEFMQVRGMLKGFIDLVFRHEGRYYLLDYKSNWLGEDSSAYTQQAMAAAMQAHRYDLQYQLYTLALHRYLRHRIADYDYEHHFGGVIYLFLRGVD
807 -> 807 T
10 -> 437 PLRLPLQGERLIEASAGTGKTFTIAALYLRLLLGLGGSAAFPRPLTVEELLVVTFTEAATAELRGRIRSNIHELRIACLRETTDNPLYERLLEEIDDKAQAAQWLLLAERQMDEAAVFTIHGFCQRMLNLNAFESGMLFEQQLIEDESLLRYQACADFWRRHCYPLPREIAQVVFETWKGPQALLRDINRYLQGEAPVIKAPPPDDETLASRHAQIVARIDTVKQQWRDAVGELDALIESSGIDRRKFNRSNQAKWIDKISAWAEEETNSYQLPESLEKFSQRFLEDRTKAGGETPRHPLFEAIDQLLAEPLSIRDLVITRALAEIRETVAREKRRRGELGFDDMLSRLDSALRSESGEVLAAAIRTRFPVAMIDEFQDTDPQQYRIFRRIWHHQPETALLLIGDPKQAIYAFRGADIFTYMKARSEV

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.2 - DNA
  2 - information transfer --> 2.1 - DNA related --> 2.1.3 - DNA recombination
  2 - information transfer --> 2.1 - DNA related --> 2.1.4 - DNA repair
  2 - information transfer --> 2.1 - DNA related --> 2.1.5 - DNA degradation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0009338 - exodeoxyribonuclease V complex
molecular_function GO:0003677 - DNA binding
GO:0003678 - DNA helicase activity
GO:0004386 - helicase activity
GO:0004518 - nuclease activity
GO:0004527 - exonuclease activity
GO:0005515 - protein binding
GO:0008094 - DNA-dependent ATPase activity
GO:0016787 - hydrolase activity
GO:0043138 - 3'-5' DNA helicase activity
GO:0046872 - metal ion binding
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0004520 - endodeoxyribonuclease activity
GO:0008854 - exodeoxyribonuclease V activity
GO:0000287 - magnesium ion binding
GO:0015616 - DNA translocase activity
biological_process GO:0006281 - DNA repair
GO:0006310 - DNA recombination
GO:0006974 - cellular response to DNA damage stimulus
GO:0009314 - response to radiation
GO:0032508 - DNA duplex unwinding
GO:0000725 - recombinational repair
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
GO:0000724 - double-strand break repair via homologous recombination
GO:0044355 - clearance of foreign intracellular DNA
Note(s): Note(s): ...[more].
Reference(s): [1] Kurilovich E., et al., 2019
External database links:  
DIP:
DIP-540N
ECOCYC:
EG10824-MONOMER
ECOLIWIKI:
b2820
INTERPRO:
IPR014017
INTERPRO:
IPR014016
INTERPRO:
IPR011604
INTERPRO:
IPR011335
INTERPRO:
IPR004586
INTERPRO:
IPR027417
INTERPRO:
IPR000212
INTERPRO:
IPR038726
INTERPRO:
IPR034739
MINT:
P08394
MODBASE:
P08394
PANTHER:
PTHR11070
PANTHER:
PTHR11070:SF23
PDB:
6T2V
PDB:
6T2U
PDB:
6SJG
PDB:
6SJF
PDB:
6SJE
PDB:
5MBV
PDB:
5LD2
PDB:
3K70
PDB:
1W36
PFAM:
PF00580
PFAM:
PF13361
PFAM:
PF12705
PRIDE:
P08394
PRODB:
PRO_000023697
PROSITE:
PS51198
PROSITE:
PS51217
REFSEQ:
NP_417297
SMR:
P08394
UNIPROT:
P08394


Operon      
Name: ptrA-recBD         
Operon arrangement:
Transcription unit        Promoter
ptrA
ptrA-recBD


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3127 2951765 reverse nd [RS-EPT-CBR] [2]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Kurilovich E., Shiriaeva A., Metlitskaya A., Morozova N., Ivancic-Bace I., Severinov K., Savitskaya E., 2019, Genome Maintenance Proteins Modulate Autoimmunity Mediated Primed Adaptation by the Escherichia coli Type I-E CRISPR-Cas System., Genes (Basel) 10(11)

 [2] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB