RegulonDB RegulonDB 10.9: Gene Form
   

recD gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

recB ptrA recD argA TSS_3127 TSS_3127

Gene      
Name: recD    Texpresso search in the literature
Synonym(s): ECK2815, EG10826, b2819, hopE
Genome position(nucleotides): 2950635 <-- 2952461 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
55.28
External database links:  
ASAP:
ABE-0009247
CGSC:
4975
ECHOBASE:
EB0819
ECOLIHUB:
recD
OU-MICROARRAY:
b2819
STRING:
511145.b2819
COLOMBOS: recD


Product      
Name: exodeoxyribonuclease V subunit RecD
Synonym(s): HopE, RecD
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 66.902
Isoelectric point: 7.015
Motif(s):
 
Type Positions Sequence
177 -> 177 K
156 -> 319 VAAAVALTRRISVISGGPGTGKTTTVAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGKALRQLPLTDEQKKRIPEDASTLHRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPDHARVIFLGDRDQLASVEAGAVLGDICAYANA
534 -> 579 WAMTVHKSQGSEFDHAALILPSQRTPVVTRELVYTAVTRARRRLSL
306 -> 306 A
247 -> 248 QP

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.2 - degradation of macromolecules --> 1.2.2 - DNA
  2 - information transfer --> 2.1 - DNA related --> 2.1.3 - DNA recombination
  2 - information transfer --> 2.1 - DNA related --> 2.1.5 - DNA degradation
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0009338 - exodeoxyribonuclease V complex
molecular_function GO:0003677 - DNA binding
GO:0003678 - DNA helicase activity
GO:0004386 - helicase activity
GO:0004518 - nuclease activity
GO:0004527 - exonuclease activity
GO:0016787 - hydrolase activity
GO:0000166 - nucleotide binding
GO:0005524 - ATP binding
GO:0008854 - exodeoxyribonuclease V activity
GO:0017116 - single-stranded DNA helicase activity
biological_process GO:0006281 - DNA repair
GO:0006310 - DNA recombination
GO:0006974 - cellular response to DNA damage stimulus
GO:0032508 - DNA duplex unwinding
GO:0006302 - double-strand break repair
GO:0090305 - nucleic acid phosphodiester bond hydrolysis
GO:0000724 - double-strand break repair via homologous recombination
Note(s): Note(s): ...[more].
Reference(s): [1] Biek DP., et al., 1986
[2] Dermic D. 2006
External database links:  
DIP:
DIP-10651N
ECOCYC:
EG10826-MONOMER
ECOLIWIKI:
b2819
INTERPRO:
IPR006344
INTERPRO:
IPR027417
INTERPRO:
IPR027785
INTERPRO:
IPR041851
INTERPRO:
IPR003593
MINT:
P04993
MODBASE:
P04993
PDB:
6T2V
PDB:
6T2U
PDB:
6SJG
PDB:
6SJF
PDB:
6SJE
PDB:
5MBV
PDB:
5LD2
PDB:
3K70
PDB:
1W36
PFAM:
PF13538
PFAM:
PF13604
PRIDE:
P04993
PRODB:
PRO_000023699
REFSEQ:
NP_417296
SMART:
SM00382
SMR:
P04993
UNIPROT:
P04993


Operon      
Name: ptrA-recBD         
Operon arrangement:
Transcription unit        Promoter
ptrA
ptrA-recBD


Transcriptional Regulation      
Display Regulation             
Repressed by: LexA


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3127 2951765 reverse nd [RS-EPT-CBR] [3]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Biek DP., Cohen SN., 1986, Identification and characterization of recD, a gene affecting plasmid maintenance and recombination in Escherichia coli., J Bacteriol 167(2):594-603

 [2] Dermic D., 2006, Functions of multiple exonucleases are essential for cell viability, DNA repair and homologous recombination in recD mutants of Escherichia coli., Genetics 172(4):2057-69

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB