RegulonDB RegulonDB 10.10: Gene Form
   

rpsN gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

rplE rpsH rpsN TSS_3770 TSS_3770 TSS_3769 TSS_3769 TSS_3768 (cluster) TSS_3768 (cluster) TSS_3767 (cluster) TSS_3767 (cluster) TSS_3766 TSS_3766 TSS_3765 TSS_3765 TSS_3764 TSS_3764 TSS_3763 TSS_3763 TSS_3762 (cluster) TSS_3762 (cluster) TSS_3761 (cluster) TSS_3761 (cluster) TSS_3760 (cluster) TSS_3760 (cluster) TSS_3759 (cluster) TSS_3759 (cluster) TSS_3758 TSS_3758 TSS_3757 TSS_3757 TSS_3756 TSS_3756 TSS_3755 (cluster) TSS_3755 (cluster) TSS_3754 (cluster) TSS_3754 (cluster) TSS_3753 TSS_3753 TSS_3752 TSS_3752 TSS_3751 TSS_3751 TSS_3750 TSS_3750

Gene      
Name: rpsN    Texpresso search in the literature
Synonym(s): ECK3294, EG10913, b3307
Genome position(nucleotides): 3446579 <-- 3446884 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
52.61
External database links:  
ASAP:
ABE-0010831
CGSC:
218
ECHOBASE:
EB0906
ECOLIHUB:
rpsN
OU-MICROARRAY:
b3307
STRING:
511145.b3307
COLOMBOS: rpsN


Product      
Name: 30S ribosomal subunit protein S14
Synonym(s): RpsN
Sequence: Get amino acid sequence Fasta Format
Cellular location: ribosome,cytosol
Molecular weight: 11.58
Isoelectric point: 11.754
Motif(s):
 
Type Positions Sequence
2 -> 101 AKQSMKAREVKRVALADKYFAKRAELKAIISDVNASDEDRWNAVLKLQTLPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKASW
92 -> 92 E
99 -> 101 ASW
47 -> 100 KLQTLPRDSSPSRQRNRCRQTGRPHGFLRKFGLSRIKVREAAMRGEIPGLKKAS

 

Classification:
Multifun Terms (GenProtEC)  
  2 - information transfer --> 2.3 - protein related --> 2.3.2 - translation
  2 - information transfer --> 2.3 - protein related --> 2.3.8 - ribosomal proteins
  6 - cell structure --> 6.6 - ribosomes
Gene Ontology Terms (GO)  
cellular_component GO:0005829 - cytosol
GO:0005840 - ribosome
GO:0015935 - small ribosomal subunit
GO:0022627 - cytosolic small ribosomal subunit
molecular_function GO:0003735 - structural constituent of ribosome
GO:0000049 - tRNA binding
GO:0019843 - rRNA binding
biological_process GO:0006412 - translation
GO:0000028 - ribosomal small subunit assembly
Note(s): Note(s): ...[more].
Reference(s): [1] Abdurashidova GG., et al., 1985
[2] Abdurashidova GG., et al., 1985
[3] Abdurashidova GG., et al., 1985
[4] Akanuma G., et al., 2021
[5] Babkina GT., et al., 1984
[6] Babkina GT., et al., 1985
[7] Babkina GT., et al., 1986
[8] Babkina GT., et al., 1987
[9] Bakardjieva A., et al., 1974
[10] Bausk EV., et al., 1985
[11] Bollen A., et al., 1975
[12] Brewer LA., et al., 1983
[13] Broude NE., et al., 1985
[14] Buck MA., et al., 1990
[15] Gibbs MR., et al., 2017
[16] Gimautdinova OI., et al., 1982
[17] Gimautdinova OI., et al., 1984
[18] Gorelic L. 1976
[19] Grant PG., et al., 1983
[20] Iusupov MM., et al., 1986
[21] Jaskunas SR., et al., 1977
[22] Jaskunas SR., et al., 1977
[23] Kakegawa T., et al., 1986
[24] Kaltschmidt E., et al., 1974
[25] Kerlavage AR., et al., 1984
[26] Lake JA., et al., 1974
[27] Lake JA., et al., 1974
[28] Lelong JC., et al., 1974
[29] Nicholson AW., et al., 1982
[30] Olah TV., et al., 1988
[31] Olson HM., et al., 1980
[32] Pintor-Toro JA., et al., 1979
[33] Potapov AP. 1988
[34] Ramakrishnan V., et al., 1984
[35] Rinke J., et al., 1977
[36] Rinke J., et al., 1976
[37] Samaha RR., et al., 1994
[38] Schendel PL., et al., 1976
[39] Spirin AS., et al., 1996
[40] Stoffler-Meilicke M., et al., 1987
[41] Tischendorf GW., et al., 1974
[42] Traut RR., et al., 1995
[43] Tukalo MA., et al., 1987
[44] Wiener L., et al., 1988
[45] Wittmann HG., et al., 1971
[46] Wittmann-Liebold B., et al., 1995
[47] Yuki A., et al., 1975
External database links:  
DIP:
DIP-35805N
ECOCYC:
EG10913-MONOMER
ECOLIWIKI:
b3307
INTERPRO:
IPR043140
INTERPRO:
IPR023036
INTERPRO:
IPR001209
INTERPRO:
IPR018271
PANTHER:
PTHR19836
PDB:
1M5G
PDB:
2YKR
PDB:
3J9Y
PDB:
3J9Z
PDB:
3JA1
PDB:
3JBU
PDB:
3JBV
PDB:
3JCD
PDB:
3JCE
PDB:
3JCJ
PDB:
3JCN
PDB:
4A2I
PDB:
4ADV
PDB:
4U1U
PDB:
4U1V
PDB:
4U20
PDB:
4U24
PDB:
4U25
PDB:
4U26
PDB:
4U27
PDB:
4V47
PDB:
4V48
PDB:
4V4H
PDB:
4V4Q
PDB:
4V4V
PDB:
4V4W
PDB:
4V50
PDB:
4V52
PDB:
4V53
PDB:
4V54
PDB:
4V55
PDB:
4V56
PDB:
4V57
PDB:
4V5B
PDB:
4V5H
PDB:
4V5Y
PDB:
4V64
PDB:
4V65
PDB:
4V66
PDB:
4V69
PDB:
4V6C
PDB:
4V6D
PDB:
4V6E
PDB:
4V6K
PDB:
4V6L
PDB:
4V6M
PDB:
4V6N
PDB:
4V6O
PDB:
4V6P
PDB:
4V6Q
PDB:
4V6R
PDB:
4V6S
PDB:
4V6T
PDB:
4V6V
PDB:
4V6Y
PDB:
4V6Z
PDB:
4V70
PDB:
4V71
PDB:
4V72
PDB:
4V73
PDB:
4V74
PDB:
4V75
PDB:
4V76
PDB:
4V77
PDB:
4V78
PDB:
4V79
PDB:
4V7A
PDB:
4V7B
PDB:
4V7C
PDB:
4V7D
PDB:
4V7I
PDB:
4V7S
PDB:
4V7T
PDB:
4V7U
PDB:
4V7V
PDB:
4V85
PDB:
4V89
PDB:
4V9C
PDB:
4V9D
PDB:
4V9O
PDB:
4V9P
PDB:
4WF1
PDB:
4WOI
PDB:
4WWW
PDB:
4YBB
PDB:
5AFI
PDB:
5H5U
PDB:
5IQR
PDB:
5IT8
PDB:
5J5B
PDB:
5J7L
PDB:
5J88
PDB:
5J8A
PDB:
5J91
PDB:
5JC9
PDB:
5JTE
PDB:
5JU8
PDB:
5KCR
PDB:
5KCS
PDB:
5KPS
PDB:
5KPV
PDB:
5KPW
PDB:
5KPX
PDB:
5L3P
PDB:
5LZA
PDB:
5LZB
PDB:
5LZC
PDB:
5LZD
PDB:
5LZE
PDB:
5LZF
PDB:
5MDV
PDB:
5MDW
PDB:
5MDY
PDB:
5MDZ
PDB:
5ME0
PDB:
5ME1
PDB:
5MGP
PDB:
5MY1
PDB:
5NO2
PDB:
5NO3
PDB:
5NO4
PDB:
5NP6
PDB:
5NWY
PDB:
5O2R
PDB:
5U4I
PDB:
5U9F
PDB:
5U9G
PDB:
5UYK
PDB:
5UYL
PDB:
5UYM
PDB:
5UYN
PDB:
5UYP
PDB:
5UYQ
PDB:
5UZ4
PDB:
5WDT
PDB:
5WE4
PDB:
5WE6
PDB:
5WFK
PDB:
6BU8
PDB:
6BY1
PDB:
6C4I
PDB:
6ENF
PDB:
6ENJ
PDB:
6ENU
PDB:
6GWT
PDB:
6GXM
PDB:
6GXN
PDB:
6GXO
PDB:
6GXP
PDB:
6H4N
PDB:
6H58
PDB:
6HRM
PDB:
6I7V
PDB:
6NQB
PDB:
6O9J
PDB:
6O9K
PDB:
6OFX
PDB:
6OG7
PDB:
6ORE
PDB:
6ORL
PDB:
6OST
PDB:
6OT3
PDB:
6OUO
PDB:
6Q97
PDB:
6Q98
PDB:
6Q9A
PDB:
6SZS
PDB:
6TBV
PDB:
6TC3
PFAM:
PF00253
PRIDE:
P0AG59
PRODB:
PRO_000023867
PROSITE:
PS00527
REFSEQ:
NP_417766
SMR:
P0AG59
SWISSMODEL:
P0AG59
UNIPROT:
P0AG59


Operon      
Name: rplNXE-rpsNH-rplFR-rpsE-rpmD-rplO-secY-rpmJ         
Operon arrangement:
Transcription unit        Promoter
rplNXE-rpsNH-rplFR-rpsE-rpmD-rplO-secY-rpmJ


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter TSS_3750 3446394 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3751 3446402 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3752 3446641 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3753 3446790 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3754 (cluster) 3446794 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3755 (cluster) 3446797 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3756 3446801 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3757 3446807 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3758 3446812 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3759 (cluster) 3446829 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3760 (cluster) 3446832 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3761 (cluster) 3446837 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3762 (cluster) 3446840 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3763 3446845 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3764 3446851 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3765 3446872 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3766 3446880 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3767 (cluster) 3447230 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3768 (cluster) 3447242 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3769 3447245 reverse nd [RS-EPT-CBR] [48]
  promoter TSS_3770 3447267 reverse nd [RS-EPT-CBR] [48]


Evidence    

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Abdurashidova GG., Nargizian MG., Rudenko NV., Turchinskii MF., Budovskii EI., 1985, [Contacts of ribosomal proteins with tRNAPhe and 16S RNA in analogs of the 30S initiation complex]., Mol Biol (Mosk) 19(2):553-7

 [2] Abdurashidova GG., Ovsepian VA., Budovskii EI., 1985, [Proteins contacting with peptidyl-tRNA at the A-site of the Escherichia coli ribosome after enzymatic and non-enzymatic binding of aminoacyl-tRNA]., Mol Biol (Mosk) 19(4):1148-52

 [3] Abdurashidova GG., Ovsepian VA., Chernyi AA., Kaminir LB., Budovskii EI., 1985, [Ribosomal proteins interacting with Phe-tRNAPhe during enzymatic binding with translating ribosome before and after the release of the elongation factor EF-Tu]., Mol Biol (Mosk) 19(3):800-4

 [4] Akanuma G., Kawamura F., Watanabe S., Watanabe M., Okawa F., Natori Y., Nanamiya H., Asai K., Chibazakura T., Yoshikawa H., Soma A., Hishida T., Kato-Yamada Y., 2021, The evolution of ribosomal protein S14 demonstrated by the reconstruction of chimeric ribosomes in Bacillus subtilis., J Bacteriol

 [5] Babkina GT., Bausk EV., Graifer DM., Karpova GG., Matasova NB., 1984, The effect of aminoacyl- or peptidyl-tRNA at the A-site on the arrangement of deacylated tRNA at the ribosomal P-site., FEBS Lett 170(2):290-4

 [6] Babkina GT., Karpova GG., Matasova NB., Berzin' VM., Gren EIa., 1985, [Study of the mRNA-binding region of ribosomes at different steps of translation. II. Affinity modification of Escherichia coli ribosomes by benzylidene derivative of AUGU6 in the 70S initiation complex]., Mol Biol (Mosk) 19(4):1079-85

 [7] Babkina GT., Veniaminova AG., Vladimirov SN., Karpova GG., Yamkovoy VI., Berzin VA., Gren EJ., Cielens IE., 1986, Affinity labelling of Escherichia coli ribosomes with a benzylidene derivative of AUGU6 within initiation and pretranslocational complexes., FEBS Lett 202(2):340-4

 [8] Babkina GT., Vladimirova IN., Vladimirov SN., Karpova GG., Tsielens IE., 1987, [Photoaffinity modification of Escherichia coli ribosomes by fMet-tRNAf Met derivatives in the 70S initiation complex]., Mol Biol (Mosk) 21(1):93-101

 [9] Bakardjieva A., Crichton RR., 1974, Topography of Escherichia coli ribosomal proteins. The order of reactivity of thiol groups., Biochem J 143(3):599-606

 [10] Bausk EV., Graifer DM., Karpova GG., 1985, [Study of the photoaffinity modification of Escherichia coli ribosomes near the donor tRNA-binding center]., Mol Biol (Mosk) 19(2):545-52

 [11] Bollen A., Heimark RL., Cozzone A., Traut RR., Hershey JW., 1975, Cross-linking of initiation factor IF-2 to Escherichia coli 30 S ribosomal proteins with dimethylsuberimidate., J Biol Chem 250(11):4310-4

 [12] Brewer LA., Noller HF., 1983, Ribonucleic acid-protein cross-linking within the intact Escherichia coli ribosome, utilizing ethylene glycol bis[3-(2-ketobutyraldehyde) ether], a reversible, bifunctional reagent: identification of 30S proteins., Biochemistry 22(18):4310-5

 [13] Broude NE., Medvedeva NI., Kusova KS., Budovskii EI., 1985, [Ribosomal proteins directly interacting with fMet-tRNAfMet in the 30S initiation complex]., Mol Biol (Mosk) 19(5):1269-72

 [14] Buck MA., Cooperman BS., 1990, Single protein omission reconstitution studies of tetracycline binding to the 30S subunit of Escherichia coli ribosomes., Biochemistry 29(22):5374-9

 [15] Gibbs MR., Moon KM., Chen M., Balakrishnan R., Foster LJ., Fredrick K., 2017, Conserved GTPase LepA (Elongation Factor 4) functions in biogenesis of the 30S subunit of the 70S ribosome., Proc Natl Acad Sci U S A 114(5):980-985

 [16] Gimautdinova OI., Karpova GG., Kozyreva NA., 1982, [Affinity labeling of ribosomes from Escherichia coli with 4-(N-2-chloroethyl-N-methylamino) benzyl-5'-phosphamides of oligouridylates of different length]., Mol Biol (Mosk) 16(4):752-62

 [17] Gimautdinova OI., Zenkova MA., Karpova GG., Podust LM., 1984, [Affinity modification of Escherichia coli ribosomes with photoactivated analogs of mRNA]., Mol Biol (Mosk) 18(4):907-18

 [18] Gorelic L., 1976, Photoinduced cross-linkage, in situ, of Escherichia coli 30S ribosomal proteins to 16S rRNA: identification of cross-linked proteins and relationships between reactivity and ribosome structure., Biochemistry 15(16):3579-90

 [19] Grant PG., Olson HM., Glitz DG., Cooperman BS., 1983, Puromycin binding to the small subunit of Escherichia coli ribosomes. Localization of the antibiotic in subunits reconstituted with puromycin-modified components., J Biol Chem 258(18):11305-12

 [20] Iusupov MM., Spirin AS., 1986, [Study of the surface of Escherichia coli ribosomes and ribosomal particles by the tritium bombardment method]., Biokhimiia 51(11):1858-67

 [21] Jaskunas SR., Fallon AM., Nomura M., 1977, Identification and organization of ribosomal protein genes of Escherichia coli carried by lambdafus2 transducing phage., J Biol Chem 252(20):7323-36

 [22] Jaskunas SR., Nomura M., 1977, Organization of ribosomal protein genes of Escherichia coli as analyzed by polar insertion mutations., J Biol Chem 252(20):7337-43

 [23] Kakegawa T., Sato E., Hirose S., Igarashi K., 1986, Polyamine binding sites on Escherichia coli ribosomes., Arch Biochem Biophys 251(2):413-20

 [24] Kaltschmidt E., Kahan L., Nomura M., 1974, In vitro synthesis of ribosomal proteins directed by Escherichia coli DNA., Proc Natl Acad Sci U S A 71(2):446-50

 [25] Kerlavage AR., Weitzmann CJ., Cooperman BS., 1984, Application of high-performance liquid chromatography to the reconstitution of ribosomal subunits., J Chromatogr 317:201-12

 [26] Lake JA., Pendergast M., Kahan L., Nomura M., 1974, Localization of Escherichia coli ribosomal proteins S4 and S14 by electron microscopy of antibody-labeled subunits., Proc Natl Acad Sci U S A 71(12):4688-92

 [27] Lake JA., Pendergast M., Kahan L., Nomura M., 1974, Ribosome structure: three-dimensional distribution of proteins S14 and S4., J Supramol Struct 2(2-4):189-95

 [28] Lelong JC., Gros D., Gros F., Bollen A., Maschler R., Stoffler G., 1974, Function of individual 30S subunit proteins of Escherichia coli. Effect of specific immunoglobulin fragments (Fab) on activities of ribosomal decoding sites., Proc Natl Acad Sci U S A 71(2):248-52

 [29] Nicholson AW., Hall CC., Strycharz WA., Cooperman BS., 1982, Photoaffinity labeling of Escherichia coli ribosomes by an aryl azide analogue of puromycin. Evidence for the functional site specificity of labeling., Biochemistry 21(16):3809-17

 [30] Olah TV., Olson HM., Glitz DG., Cooperman BS., 1988, Incorporation of single dinitrophenyl-modified proteins into the 30 S subunit of Escherichia coli ribosomes by total reconstitution., J Biol Chem 263(10):4795-800

 [31] Olson HM., Grant PG., Glitz DG., Cooperman BS., 1980, Immunoelectron microscopic localization of the site of photo-induced affinity labeling of the small ribosomal subunit with puromycin., Proc Natl Acad Sci U S A 77(2):890-4

 [32] Pintor-Toro JA., Vazquez D., Palacian E., 1979, Reversible modification of Escherichia coli ribosomes with 2,3-dimethylmaleic anhydride. A new method to obtain protein-deficient ribosomal particles., Biochemistry 18(15):3219-23

 [33] Potapov AP., 1988, [The structure of ribosome decoding center]., Mol Biol (Mosk) 22(4):917-22

 [34] Ramakrishnan V., Capel M., Kjeldgaard M., Engelman DM., Moore PB., 1984, Positions of proteins S14, S18 and S20 in the 30 S ribosomal subunit of Escherichia coli., J Mol Biol 174(2):265-84

 [35] Rinke J., Ross A., Brimacombe R., 1977, Characterisation of RNA fragments obtained by mild nuclease digestion of 30-S ribosomal subunits from Escherichia coli., Eur J Biochem 76(1):189-96

 [36] Rinke J., Yuki A., Brimacombe R., 1976, Studies on the environment of protein S7 within the 30-S subunit Escherichia coli ribosomes., Eur J Biochem 64(1):77-89

 [37] Samaha RR., O'Brien B., O'Brien TW., Noller HF., 1994, Independent in vitro assembly of a ribonucleoprotein particle containing the 3' domain of 16S rRNA., Proc Natl Acad Sci U S A 91(17):7884-8

 [38] Schendel PL., Craven GR., 1976, Studies on the ability of partially iodinated 16S RNA to participate in 30S ribosome assembly., Nucleic Acids Res 3(11):3001-14

 [39] Spirin AS., Agafonov DE., Kolb VA., Kommer A., 1996, [Topography of ribosomal proteins: reconsideration of of protein map of small ribosomal subunit]., Biokhimiia 61(11):1928-30

 [40] Stoffler-Meilicke M., Stoffler G., 1987, The topography of ribosomal proteins on the surface of the 30S subunit of Escherichia coli., Biochimie 69(10):1049-64

 [41] Tischendorf GW., Zeichhardt H., Stoffler G., 1974, Location of proteins S5, S13 and S14 on the surface of the 3oS ribosomal subunit from Escherichia coli as determined by immune electron microscopy., Mol Gen Genet 134(3):209-23

 [42] Traut RR., Dey D., Bochkariov DE., Oleinikov AV., Jokhadze GG., Hamman B., Jameson D., 1995, Location and domain structure of Escherichia coli ribosomal protein L7/L12: site specific cysteine crosslinking and attachment of fluorescent probes., Biochem Cell Biol 73(11-12):949-58

 [43] Tukalo MA., Kubler MD., Kern D., Mougel M., Ehresmann C., Ebel JP., Ehresmann B., Giege R., 1987, trans-Diamminedichloroplatinum(II), a reversible RNA-protein cross-linking agent. Application to the ribosome and to an aminoacyl-tRNA synthetase/tRNA complex., Biochemistry 26(16):5200-8

 [44] Wiener L., Schuler D., Brimacombe R., 1988, Protein binding sites on Escherichia coli 16S ribosomal RNA; RNA regions that are protected by proteins S7, S9 and S19, and by proteins S8, S15 and S17., Nucleic Acids Res 16(4):1233-50

 [45] Wittmann HG., Stofflet G., Hindennach I., Kurland CG., Birge EA., Randall-Hazelbauer L., Nomura M., Kaltschmidt E., Mizushima S., Traut RR., Bickle TA., 1971, Correlation of 30S ribosomal proteins of Escherichia coli isolated in different laboratories., Mol Gen Genet 111(4):327-33

 [46] Wittmann-Liebold B., Uhlein M., Urlaub H., Muller EC., Otto A., Bischof O., 1995, Structural and functional implications in the eubacterial ribosome as revealed by protein-rRNA and antibiotic contact sites., Biochem Cell Biol 73(11-12):1187-97

 [47] Yuki A., Brimacombe R., 1975, Nucleotide sequences of Escherichia coli 16-S RNA associated with ribosomal proteins S7, S9, S10, S14 and S19., Eur J Biochem 56(1):23-34

 [48] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB