RegulonDB RegulonDB 10.9: Gene Form
   

trxB gene in Escherichia coli K-12 genome


Gene local context to scale (view description)

cydD trxB lrp NsrR Lrp Lrp Lrp Lrp NarL FNR NarL ppGpp anti-anti-terminator anti-terminator terminator ftsKp2 ftsKp2 TSS_1062 TSS_1062 TSS_1061 TSS_1061 TSS_1060 TSS_1060 lrpp lrpp trxBp trxBp cydDp cydDp TSS_1059 TSS_1059 TSS_1058 TSS_1058 cydCp5 cydCp5

Gene      
Name: trxB    Texpresso search in the literature
Synonym(s): ECK0879, EG11032, b0888, trxR
Genome position(nucleotides): 931085 <-- 932050 Genome Browser
Strand: reverse
Sequence: Get nucleotide sequence FastaFormat
GC content %:  
53.62
Reference(s): [1] Russel M., et al., 1985
External database links:  
ASAP:
ABE-0003018
CGSC:
17569
ECHOBASE:
EB1025
ECOLIHUB:
trxB
OU-MICROARRAY:
b0888
STRING:
511145.b0888
COLOMBOS: trxB


Product      
Name: thioredoxin reductase
Synonym(s): TrxB, TrxR, thioredoxin reductase (NADPH)
Sequence: Get amino acid sequence Fasta Format
Cellular location: cytosol
Molecular weight: 34.623
Isoelectric point: 5.207
Motif(s):
 
Type Positions Sequence
287 -> 296 DVMDHIYRQA
8 -> 300 KLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSA
36 -> 43 TGMEKGGQ
2 -> 321 GTTKHSKLLILGSGPAGYTAAVYAARANLQPVLITGMEKGGQLTTTTEVENWPGDPNDLTGPLLMERMHEHATKFETEIIFDHINKVDLQNRPFRLNGDNGEYTCDALIIATGASARYLGLPSEEAFKGRGVSACATCDGFFYRNQKVAVIGGGNTAVEEALYLSNIASEVHLIHRRDGFRAEKILIKRLMDKVENGNIILHTNRTLEEVTGDQMGVTGVRLRDTQNSDNIESLDVAGLFVAIGHSPNTAIFEGQLELENGYIKVQSGIHGNATQTSIPGVFAAGDVMDHIYRQAITSAGTGCMAALDAERYLDGLADAK

 

Classification:
Multifun Terms (GenProtEC)  
  1 - metabolism --> 1.7 - central intermediary metabolism --> 1.7.1 - unassigned reversible reactions
Gene Ontology Terms (GO)  
cellular_component GO:0005737 - cytoplasm
GO:0005829 - cytosol
molecular_function GO:0005515 - protein binding
GO:0016491 - oxidoreductase activity
GO:0050660 - flavin adenine dinucleotide binding
GO:0004791 - thioredoxin-disulfide reductase activity
biological_process GO:0019430 - removal of superoxide radicals
GO:0055114 - oxidation-reduction process
External database links:  
DIP:
DIP-6168N
ECOCYC:
THIOREDOXIN-REDUCT-NADPH-MONOMER
ECOLIWIKI:
b0888
INTERPRO:
IPR036188
INTERPRO:
IPR023753
INTERPRO:
IPR008255
INTERPRO:
IPR005982
MODBASE:
P0A9P4
PDB:
1TDE
PDB:
1TRB
PDB:
1TDF
PDB:
1F6M
PDB:
1CL0
PFAM:
PF07992
PRIDE:
P0A9P4
PRODB:
PRO_000024130
PROSITE:
PS00573
REFSEQ:
NP_415408
SMR:
P0A9P4
UNIPROT:
P0A9P4


Operon      
Name: trxB         
Operon arrangement:
Transcription unit        Promoter
trxB


Elements in the selected gene context region unrelated to any object in RegulonDB      

  Type Name Post Left Post Right Strand Notes Evidence (Confirmed, Strong, Weak) References
  promoter cydCp5 929400 reverse Similarity to the consensus
Read more >
[ICWHO] [2]
  promoter TSS_1058 929741 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1059 930998 reverse nd [RS-EPT-CBR] [3]
  promoter TSS_1060 932431 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1061 932507 forward nd [RS-EPT-CBR] [3]
  promoter TSS_1062 932525 forward nd [RS-EPT-CBR] [3]


Evidence    

 [ICWHO] Inferred computationally without human oversight

 [RS-EPT-CBR] RNA-seq using two enrichment strategies for primary transcripts and consistent biological replicates



Reference(s)    

 [1] Russel M., Model P., 1985, Direct cloning of the trxB gene that encodes thioredoxin reductase., J Bacteriol 163(1):238-42

 [2] Huerta AM., Collado-Vides J., 2003, Sigma70 promoters in Escherichia coli: specific transcription in dense regions of overlapping promoter-like signals., J Mol Biol 333(2):261-78

 [3] Salgado H, Peralta-Gil M, Gama-Castro S, Santos-Zavaleta A, Muñiz-Rascado L, García-Sotelo JS, Weiss V, Solano-Lira H, Martínez-Flores I, Medina-Rivera A, Salgado-Osorio G, Alquicira-Hernández S, Alquicira-Hernández K, López-Fuentes A, Porrón-Sotelo L, Huerta AM, Bonavides-Martínez C, Balderas-Martínez YI, Pannier L, Olvera M, Labastida A, Jiménez-Jacinto V, Vega-Alvarado L, Del Moral-Chávez V, Hernández-Alvarez A, Morett E, Collado-Vides J., 2012, RegulonDB v8.0: omics data sets, evolutionary conservation, regulatory phrases, cross-validated gold standards and more., Nucleic Acids Res.


RegulonDB